DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac2 and CYP96A12

DIOPT Version :9

Sequence 1:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_195661.1 Gene:CYP96A12 / 830105 AraportID:AT4G39510 Length:508 Species:Arabidopsis thaliana


Alignment Length:499 Identity:116/499 - (23%)
Similarity:199/499 - (39%) Gaps:105/499 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 IFNFMRDASAKAKGRNYLWYFFHAP------MYNIVRAEEAEEILQSS-KLITKNMIYELLKPFL 128
            |:||    ..:|...::|.:.|..|      |...|.......||.|: ...||...::.:....
plant    51 IYNF----GVEALEMSHLTFLFKGPWFAEMDMLFTVDPANIHYILSSNFSNYTKGADFKEVFDVF 111

  Fly   129 GEGLLISTDQKWHSRRKAL-------------TPAFHFKVLQSFLIIFKEECNKLVKVLHQSVNM 180
            ||.:..|..:.|.::|||.             ..|...|:....:.:|.:.|.: .||       
plant   112 GEMIFSSDSELWKNQRKAAQFMLNHQGFQKLSLSATRSKLYDGLVPLFNQCCEE-EKV------- 168

  Fly   181 ELELNQVIPQFTLN----------------NVCETALGVKLDDLSEGIRYRQSIHAIEEVMQQRL 229
             ::|.||..:||.:                .:.|......||||.|||.||            .:
plant   169 -VDLQQVFQRFTFDTTFFIVTGFDPKSLSIEMPEVEYAKALDDLGEGIFYR------------HI 220

  Fly   230 CNPFFYNIVYFFLFGDYRKQVNNLKIAHEFSSNIIEKRRSLFKSNQL-----GQEDEFGKKQRYA 289
            ...||:.:...|..|..::...........|:..|..:|...:|..:     |:.::.  ...:.
plant   221 KPKFFWKLQNRFGLGQEKRMTEADATFDRVSAKYILAKREEIRSQGIDHHANGESEDL--LTSHI 283

  Fly   290 MLDTLLAAEADGQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEI--KYLP 352
            .||| ...|.....|.:.:.|.:..|...|.||||:.|.:...:|:.:..|..|..:||  |.:.
plant   284 KLDT-TKYELLNPSDDKFLRDTILAFNLAGRDTTSSALSWFFWLLSENPQVVTKIRKEIIDKNIS 347

  Fly   353 DDSDDISVFQFNELVYMECVIKESLRLFPSVPFIGRRCVEEGVV-NGLIMPKNTQINIHLYEIMR 416
            .|..: .....::|||:...:.||:||:|.|.|..:..::..|: :|..:..|:.|.|.|:.:.|
plant   348 KDGRN-GQENLDKLVYLHAALYESMRLYPPVAFQRKSPIKPDVLPSGHKVEANSVIIIFLFALGR 411

  Fly   417 -------DARHFSNPKMFQPDRFFPENTVNRH--PFAFVPFSAGQRNCIGQKFAILEIKVLLAAV 472
                   ||..      |:|:|:..|:...||  .|.|:.|:||.|.|.|::.|:..:|.::..:
plant   412 MRAVWGEDATE------FKPERWVSESGGLRHAPSFKFLSFNAGPRTCPGKQLAMTLMKTVVVEI 470

  Fly   473 IRNF--------KILPVTLLDDLTFENGIVLRTKQNIKVKLVHR 508
            ::|:        ||.|         |.|::|..|..::|.:..|
plant   471 LQNYDIDVIKGQKIEP---------EPGLMLHMKHGLRVTITKR 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 115/494 (23%)
CYP96A12NP_195661.1 CYP86A 66..498 CDD:410687 109/471 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.