DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac2 and CYP702A6

DIOPT Version :9

Sequence 1:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_680696.2 Gene:CYP702A6 / 827207 AraportID:AT4G15396 Length:475 Species:Arabidopsis thaliana


Alignment Length:424 Identity:85/424 - (20%)
Similarity:163/424 - (38%) Gaps:91/424 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 EILQSSKLITKNMIYELLKPFLGEGLLISTDQKWHSRRKALT------PAFHFKVLQ--SFLI-- 161
            ||.:::.:  ..|...|.:.|....|.::.|...|:|  :||      .|...::||  .||:  
plant    95 EIAKTNHI--PGMPKSLARLFGANNLFVNKDTHKHAR--SLTNQFLGSQALKLRMLQDIDFLVRT 155

  Fly   162 IFKEECNKLVKVLHQSVNMELELNQVIPQFTLNNVCETALGVKLDDLSEGIRYRQSIHAIEEVMQ 226
            ..||...|          ..|::.:...:..:..:.:..:|....|.::               :
plant   156 HLKEGARK----------GSLDIKETTSKIIIECLAKKVMGEMEPDAAK---------------E 195

  Fly   227 QRLCNPFFYNIVYFFLF-----GDYRKQVNNLKIAHEFSSNIIEKRRSLFKSNQLGQ--EDEFGK 284
            ..||..||....:.|.:     |.||......::.......:::||.|   ..:||.  :..||.
plant   196 LTLCWTFFPREWFGFAWNIPGTGVYRMVKARNRMMKVLKETVLKKRAS---GEELGDFFKTIFGD 257

  Fly   285 KQRYAMLDTLLAAEADGQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEE-- 347
            .:|.....:|.:|           .:.:.|......:||...|..|:.:::.|..|.::...|  
plant   258 TERGVKTISLESA-----------TEYIFTLFLLANETTPAVLAATIKLISDHPKVMQELQREHE 311

  Fly   348 ----IKYLPDDSDDISVFQFNELVYMECVIKESLRLFPSVPFIGRRCVEEGVVNGLIMPKNTQIN 408
                .|...::..|::...:..:.:.:.||.||||:..:||.:.|....|.......:|......
plant   312 GIVRDKIEKNEKADLTWEDYKSMTFTQMVINESLRITSTVPTVLRIIDHEFQFGEYTIPAGWIFM 376

  Fly   409 IHLYEIMRDARHFSNPKMFQPDRFFPEN---TVNRHPFAFVPFSAGQRNCIGQKFAILEIKVLL- 469
            .:.| :..:|..:.:|..|.|.|:..::   .|:|   .::||.:|.|.|:|.:|..|::.:.: 
plant   377 GYPY-VHFNAEKYDDPLAFNPWRWKGKDLSAIVSR---TYIPFGSGSRLCVGAEFVKLKMAIFIH 437

  Fly   470 ------------AAVIRNF-KILP----VTLLDD 486
                        ..::|.| .|||    |.:|:|
plant   438 HLSRYRWSMKTETTLLRRFVLILPRGSDVQILED 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 85/424 (20%)
CYP702A6NP_680696.2 p450 9..454 CDD:299894 77/405 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.