DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac2 and CYP702A8

DIOPT Version :9

Sequence 1:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_189648.1 Gene:CYP702A8 / 822729 AraportID:AT3G30290 Length:408 Species:Arabidopsis thaliana


Alignment Length:387 Identity:76/387 - (19%)
Similarity:153/387 - (39%) Gaps:70/387 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 GEGLLISTDQKWHSR--RKALTPAFHFKVLQSF-----LIIFKEECNKLVKVLH----QSVNMEL 182
            |..::||.|.:.:..  :...||.....:.:.|     |.:...|.:|.|:.|.    .|.:::|
plant    11 GGKVIISMDNELNMEMAKTNRTPGITKSIARLFGEDNNLFLQSTESHKHVRNLTVQMLGSQSLKL 75

  Fly   183 ELNQVIPQFTLN-----------NVCETALGVKLDDLSEGIRYRQSIHAIEEVMQQRLCNPFFYN 236
            .:.:.|...|..           :|.||...:.::.|::.:.......|.:::   .||..:|.:
plant    76 RIMENIDLLTRTHMEEGARDGSLDVKETTSKILIECLAKKVMGEMEPEAAKKL---ALCWRYFPS 137

  Fly   237 IVYFFLFGDYRKQVN-------NLKIAHEFSSNIIEKRRSLFKSNQLGQE-DEFGKKQRYAMLDT 293
                   |.:|...|       |:..|.:....::  :..:.|..:.|:| .||.|         
plant   138 -------GWFRLPFNLPGIGVYNMMKARKRMKTLL--KEEVLKKREAGEEFGEFSK--------- 184

  Fly   294 LLAAEADGQ---IDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEIKYLPDDS 355
            ::..|.:|:   :..:.:.:.:.||.....:||...|..|:..::.:..|.::...|...:.::.
plant   185 IIFGEKEGEKETMSMKNVIEYIYTFFVIANETTPRILAATVKFISENPKVMQELQREHAMIFENK 249

  Fly   356 DD---ISVFQFNELVYMECVIKESLRLFPSVPFIGRRCVEEGVVNGLIMPKNTQI----NIHLYE 413
            .:   ::...:..:.:...||.||||:..:||.|.|:...:..|....:|.....    :.|.  
plant   250 SEEAGLTWEDYKSMTFTNMVINESLRISTTVPVILRKPDHDTKVGDYTIPAGWNFMGYPSAHF-- 312

  Fly   414 IMRDARHFSNPKMFQPDRFFPENTVNRHPFAFVPFSAGQRNCIGQKFAILEIKVLLAAVIRN 475
               |...:.:|..|.|.|:...:........::||.||.|.|:|..||    |:|:|..|.:
plant   313 ---DPTKYEDPLEFNPWRWKGNDLDAIVSTNYIPFGAGPRLCVGAYFA----KLLMAIFIHH 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 76/387 (20%)
CYP702A8NP_189648.1 p450 5..374 CDD:299894 76/387 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.