DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac2 and CYP94B2

DIOPT Version :9

Sequence 1:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_566155.1 Gene:CYP94B2 / 821263 AraportID:AT3G01900 Length:496 Species:Arabidopsis thaliana


Alignment Length:414 Identity:93/414 - (22%)
Similarity:178/414 - (42%) Gaps:52/414 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 ELLKPFLGEGLLISTDQKWHSRRKALTPAFHFKVLQSFLIIFKEECNK-LVKVLHQSV--NMELE 183
            |:|..|||.|:.......|..:|:..|..|..|.|:.::.:.:.|..| |:..|:.:.  :...:
plant   105 EILGDFLGNGIFNVDGNLWLKQRRLATHDFTPKSLREYVTVLRNEVEKELLAFLNAAAEDSQPFD 169

  Fly   184 LNQVIPQFTLNNVCETALGV---KLDDLSEGIRYRQSIHAIEEVMQQRLCNPF-----FYNIVYF 240
            |.:::.:||.|.||...||:   .|:..|....:.::......|...|...|.     |..:|.|
plant   170 LQELLRRFTFNIVCIVFLGIDRCTLNPSSPVSEFDRAFQTASAVSAGRGSAPLSFVWKFKRLVGF 234

  Fly   241 FLFGDYRKQVNNLKIAHEFSSNIIEKRRSLFKSNQLGQEDEFGKKQRYAMLDTL----LAAEADG 301
            ....:.||.|..:   |.....||.                 .||::.|..|.|    :|.|:| 
plant   235 GSEKELRKAVGEV---HNCVDEIIR-----------------DKKRKPANQDFLSRLIVAGESD- 278

  Fly   302 QIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEIKYLPDD-SDDISVFQFNE 365
                :.:.|.|.:.:..|.||||........::..||:.:.....||:.:.:: :.........:
plant   279 ----ETVRDMVISIIMAGRDTTSAVATRLFWLITGHEETEHDLVSEIRSVKEEITGGFDYESLKK 339

  Fly   366 LVYMECVIKESLRLFPSVPFIGRRCV-EEGVVNGLIMPKNTQINIHLYEIMRDARHFSNP-KMFQ 428
            |..::..:.|.:||:|.||:..:..: ::.:.:|.::....::....|.:.|....:... ..|:
plant   340 LSLLKACLCEVMRLYPPVPWDSKHALTDDRLPDGTLVRAGDRVTYFPYGMGRMEELWGEDWDEFK 404

  Fly   429 PDRFFP--ENTVNR-----HPFAFVPFSAGQRNCIGQKFAILEIKVLLAAVIRNFKILPVTLLDD 486
            |:|:..  :.|..|     :||.|..|.||.|.|:|::.|.:::|.::|:::..|:|.|:. .|.
plant   405 PNRWAESYDKTCCRVLKKVNPFKFPVFQAGPRVCLGEEMAYVQMKYIVASILDRFEIEPIP-TDK 468

  Fly   487 LTFENGIVLRTKQNIKVKLVHREN 510
            ..|...:.......::|: |||.:
plant   469 PDFVPMLTAHMAGGMQVR-VHRRD 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 90/407 (22%)
CYP94B2NP_566155.1 CYP86A 65..483 CDD:410687 89/403 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.