DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac2 and CYP709B2

DIOPT Version :9

Sequence 1:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_182218.2 Gene:CYP709B2 / 819309 AraportID:AT2G46950 Length:572 Species:Arabidopsis thaliana


Alignment Length:422 Identity:113/422 - (26%)
Similarity:194/422 - (45%) Gaps:57/422 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 GRNYLWYFFHAPMYNIVRAEEAEEILQS-----SKLITKNMIYELLKPFLGEGLLISTDQKWHSR 143
            |..:|::....|...|...|.|::||.:     ||..||.   |:|| ..|.||:......|...
plant   150 GETFLYWQGTDPRLCISDHELAKQILSNKFVFFSKSKTKP---EILK-LSGNGLIFVNGLDWVRH 210

  Fly   144 RKALTPAF---HFKVLQSFLIIFKEEC--NKLVKVLHQSVNMELE----LNQVIPQFTLNNVCET 199
            |:.|.|||   ..|::...::    :|  ...::...|...:|.|    :::...:.|.:.:...
plant   211 RRILNPAFSMDKLKLMTQLMV----DCTFRMFLEWKKQRNGVETEQFVLISREFKRLTADIIATA 271

  Fly   200 ALGVKLDDLSEGIRYRQSIHAIEEVMQQRLCNPFFYNIVYFFLFGDYRKQVNNL---KIAHEFSS 261
            |.|   ...:|||...:|...:::.....|.:.:|..|       .|....:||   |:..:.:|
plant   272 AFG---SSYAEGIEVFKSQLELQKCCAAALTDLYFPGI-------QYLPTPSNLQIWKLDMKVNS 326

  Fly   262 NIIEKRRSLFKSNQLGQEDEFGKKQRYAMLDTLLAAEADGQIDHQGICDEVNTFMFEGYDTTSTC 326
            :|    :.:..:....:..::|......||....:.|::.::....|.:|..||.|.|::||:..
plant   327 SI----KRIIDARLTSESKDYGNDLLGIMLTAASSNESEKKMSIDEIIEECKTFFFAGHETTANL 387

  Fly   327 LIFTLLMLALHEDVQKKCYEEI------KYLPDDSDDISVFQFNELVYMECVIKESLRLFPSVPF 385
            |.::.::|:||:|.|:|..||:      ..:||..      ..::|..|..|..|||||:..|..
plant   388 LTWSTMLLSLHQDWQEKLREEVFNECGKDKIPDAE------TCSKLKLMNTVFMESLRLYGPVLN 446

  Fly   386 IGRRCVEEGVVNGLIMPKNTQINIHLYEIMRD-ARHFSNPKMFQPDRFFPENTVNR---HPFAFV 446
            :.|...|:..:..|.:||.|.|.:.:.::.|| |...|:...|.|.||  .|.::|   ||.|.:
plant   447 LLRLASEDMKLGNLEIPKGTTIILPIAKMHRDKAVWGSDADKFNPMRF--ANGLSRAANHPNALL 509

  Fly   447 PFSAGQRNCIGQKFAILEIKVLLAAVIRNFKI 478
            .||.|.|.||||.|||:|.|.:||.:::.|::
plant   510 AFSMGPRACIGQNFAIMEAKTVLAMILQRFRL 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 113/422 (27%)
CYP709B2NP_182218.2 p450 89..571 CDD:299894 113/422 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.