DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac2 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:445 Identity:132/445 - (29%)
Similarity:225/445 - (50%) Gaps:61/445 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 WYFFHAPMYNIVRAEEAEEILQSSKLITKNMIYELLKPFLGEGLLISTDQKWHSRRKALTPAFHF 153
            :::.:.|.|..:.....:..:|        .:::||.|.:|.|||.....:|...|..||||||.
Mouse    90 FFYIYDPDYAKIFLSRTDPKMQ--------YLHQLLTPCIGRGLLNLDGPRWFQHRCLLTPAFHQ 146

  Fly   154 KVLQSFLIIFKEECNKLVKVLHQSVNMEL--------------ELNQVIPQFTLNNVCETALGVK 204
            .:|        :.|   |..:..||.:.|              |:.:.|...||:.:.:.|.|.:
Mouse   147 DIL--------KPC---VDTMAHSVKVMLDKWEKMWTTQETTIEVFEHINLMTLDIIMKCAFGQE 200

  Fly   205 LDDLSEGI--RYRQSIHAIEEVMQQRLCNPFFYNIVYFFLF--GDYRKQVNNLKIAHEFSSNIIE 265
            .:....|.  .|.::...:.|::..||.|.:.::.:.|.|.  |...:::.  |:.|:::..||:
Mouse   201 TNCQINGTYESYVKATFELGEIISSRLYNFWHHHDIIFKLSPKGHCFQELG--KVIHQYTEKIIQ 263

  Fly   266 KRRSLFKSNQLGQEDEFGKKQRYAMLDTLLAAEADGQIDHQGICD-----EVNTFMFEGYDTTST 325
            .|:.:.| ||:.|:|   .:.....||.:|:|:|:   |.:...|     ||||||:.|:|.::.
Mouse   264 DRKKILK-NQVKQDD---TQTSQIFLDIVLSAQAE---DERAFSDADLRAEVNTFMWAGHDASAA 321

  Fly   326 CLIFTLLMLALHEDVQKKCYEEIKYLPDDSDDISVFQFNELVYMECVIKESLRLFPSVPFIGRRC 390
            .:.:.|..|||:.:.|.:|..||:.:..|...|:..|.:|:.|....|||:|||.|.||.|.|..
Mouse   322 SISWLLYCLALNPEHQDRCRTEIRSILGDGSSITWEQLDEMSYTTMCIKETLRLIPPVPSISREL 386

  Fly   391 VEE-GVVNGLIMPKNTQINIHLYEIMRDARHFSNPKMFQPDRFFPENTVNRHPFAFVPFSAGQRN 454
            .:. .:.:|..:|....:.:.::.:..:...:::||:|.|.||..||:..|||.||:|||:|.||
Mouse   387 SKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWNDPKVFDPLRFTKENSDQRHPCAFLPFSSGPRN 451

  Fly   455 CIGQKFAILEIKVLLAAVIRNFKILPVTLLDDLT----FENGIVLRTKQNIKVKL 505
            ||||:||:||:||.:|.::.:|::.|     |||    |.:..|||.|..|.:.|
Mouse   452 CIGQQFAMLELKVAIALILLHFQVAP-----DLTRPPAFSSHTVLRPKHGIYLHL 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 131/443 (30%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 131/441 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.