DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac2 and Cyp313a3

DIOPT Version :9

Sequence 1:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster


Alignment Length:469 Identity:126/469 - (26%)
Similarity:227/469 - (48%) Gaps:24/469 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KIYVAPSKTRFGNNFDLVNFTSESIFNFMRDASAKAK-----GRNYLWYFFHAPMYNIVRAEEAE 106
            ::|:...|........::....|.:..:.|..|.:.|     |...|.:....|.......:.||
  Fly    24 RLYMMHFKIPGPMGLPILGIAFEYLITYKRKMSIRTKYMDIYGSTCLVWVGPTPFVITRDPKIAE 88

  Fly   107 EILQSSKLITKNMIYELLKPF---LGEGLLISTDQKWHSRRKALTPAFHFKVLQSFLIIFKEECN 168
            ||..|.:.:.::.|:.  ||.   .|:|||.....||..|||.|.|||...||.|||.||..|..
  Fly    89 EIFLSPECLNRSSIFS--KPVNSCTGDGLLSLEASKWVDRRKNLNPAFKQNVLLSFLPIFNSEAK 151

  Fly   169 KLVKVLHQSVNM-ELELNQVIPQFTLNNVCETALG--VKLDDLSEGIRYRQSIHAIEEVMQQRLC 230
            .||..|...|.. |.::...|.:::.....:|.:|  ||.|...:.....:|.....:::...:.
  Fly   152 TLVAFLDSLVGQGEKKVRDDIVRWSFRIATQTTVGTDVKKDASFKNDSVLKSYETFMKIIVMNVL 216

  Fly   231 NPFFYNIVYFFLFGDYRKQVNNLKIAHEFSSNIIEKRRSLFKSNQLGQEDEFGKKQRYAMLDTLL 295
            .||.:|.::..|.|...::.......::....|::|:  |....:.|.:.|.     .::::..:
  Fly   217 LPFTHNKIFSTLGGFETQKALAKSNVNKMIGTIVDKK--LMTKPESGSQPEI-----TSVINKAI 274

  Fly   296 AAEADGQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEIKYL-PDDSD-DI 358
            ....:|::..:.:..|..:|:...::||...:...|::||:..:.|...|:|:|.| |...| ::
  Fly   275 ELHRNGEMSREEVQSECCSFVVAAFETTGDTVYHALILLAMFPEHQDTVYQELKELFPVAGDFEV 339

  Fly   359 SVFQFNELVYMECVIKESLRLFPSVPFIGRRCVEE-GVVNGLIMPKNTQINIHLYEIMRDARHF- 421
            :......:|::|.|:.|:|||.|||||..|..:.: .:.:|:::||...|.|.::...|:..|: 
  Fly   340 TYDDLQRMVFLERVVNETLRLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWG 404

  Fly   422 SNPKMFQPDRFFPENTVNRHPFAFVPFSAGQRNCIGQKFAILEIKVLLAAVIRNFKILPVTLLDD 486
            ::|..|.||.|.|:|..:|||:|::|||.|:|||||.|:.::..|:.|:.::||.|:......:|
  Fly   405 TDPSSFNPDHFLPDNVRDRHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYED 469

  Fly   487 LTFENGIVLRTKQN 500
            |.|.:.|.:...|:
  Fly   470 LEFVDNIGMELAQS 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 124/459 (27%)
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 119/438 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I1949
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.