DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac2 and Cyp318a1

DIOPT Version :9

Sequence 1:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_727590.1 Gene:Cyp318a1 / 32172 FlyBaseID:FBgn0030369 Length:536 Species:Drosophila melanogaster


Alignment Length:449 Identity:111/449 - (24%)
Similarity:200/449 - (44%) Gaps:49/449 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 EEILQSSKLITKNMIYELLKPFLGEGLLISTDQKWHSRRKALTPAFHFKVLQSFLIIFKEECNKL 170
            |.:|.:.:.:.|..:.:..  |:..|||.:..|||..|||.|.|||...::.||..:|....|::
  Fly    91 ECVLNAPECLDKTFLQDGF--FVRRGLLHARGQKWKLRRKQLNPAFSHNIVASFFDVFNSVGNQM 153

  Fly   171 VKVLHQSVNME------LELNQVIPQFTLNNVCETALG-----VKLDDLSEGIRYRQSIHAIEEV 224
            |:......|:.      .....::.:..|...|.|.:|     .:|||......|::.:    |:
  Fly   154 VEQFQTQTNLHGQAVKFTAAEDLLSRAVLEVSCLTIMGTPTNFTQLDDAHIAHSYKRLL----EI 214

  Fly   225 MQQRLCNPFF-YNIVYFFLFGD-YRKQVNNLKIAHEFSSNIIE-KRRSLFKSNQLG----QEDEF 282
            ...|:..|:. ..:::..|..: |.:.....|:..:|...|:. |.|:....:.:|    .||..
  Fly   215 SAVRVVKPWLQIRLLHRLLAPELYEESKKCAKLLEDFVGGIVRTKHRNWRLRDAVGGEKSGEDAS 279

  Fly   283 GKKQRYAMLDTLLAAEADGQIDHQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHE-DVQKKCYE 346
            ...||...::.:....|:|::..:.|.||..:.:...::|.|..::..||.||.:: |.|::...
  Fly   280 NGWQRRIFIEQIFQLAANGEMTLEEIMDEAQSMVLVSFETVSNSIMLALLCLATNKGDCQRRLLA 344

  Fly   347 EIKYLPDDSDDISVFQFNELVYMECVIKESLRLFPSVPF----IGRRCVEEGVVNGLIMPKNTQI 407
            ||:.|..|...:.:.|..:|.|::..:.|||||..:||.    :.|.....|..:..|:|:|:.:
  Fly   345 EIRALVPDVGQVGLEQLQQLRYLDAFVSESLRLLATVPMNLRHVSRDFRLAGRQHETIVPQNSIV 409

  Fly   408 NIHLYEIMRDARHF-SNPKMFQPDRFFPENTV-------------------NRHPFAFVPFSAGQ 452
            .:..:.:.||.|.: :|.:.|.|.||..:...                   .||.::|:|||.|.
  Fly   410 VLDTFNMQRDERWWGANARQFDPQRFLDQEEEQLSKGHNDSGSGEKRRQRDRRHSYSFLPFSNGL 474

  Fly   453 RNCIGQKFAILEIKVLLAAVIRNFKILPVTLLDDLTFENGIVLRTKQNIKVKLVHRENK 511
            |:|||:::.:..:||.|..:|.||.......|:.|.|...|.|:.|....:.|..:..|
  Fly   475 RSCIGRRYGLFIMKVFLVKLITNFDFQSDFELEKLQFVENISLKFKNADDILLTIQPKK 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 109/441 (25%)
Cyp318a1NP_727590.1 p450 42..503 CDD:299894 103/417 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I1949
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1605
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.