DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac2 and CYP4A22

DIOPT Version :9

Sequence 1:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_001010969.2 Gene:CYP4A22 / 284541 HGNCID:20575 Length:519 Species:Homo sapiens


Alignment Length:398 Identity:122/398 - (30%)
Similarity:209/398 - (52%) Gaps:24/398 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 YELLKPFLGEGLLISTDQKWHSRRKALTPAFHFKVLQSFLIIFKEECNKLVKVLHQSVNME--LE 183
            |:.|.|.:|.|||:...|.|...|:.||||||..:|:.::.:..:....::....:.:..:  ||
Human   120 YKFLAPRIGYGLLLLNGQTWFQHRRMLTPAFHNDILKPYVGLMADSVRVMLDKWEELLGQDSPLE 184

  Fly   184 LNQVIPQFTLNNVCETAL----GVKLDDLSEGIRYRQSIHAIEEVMQQRLCNPFFYNIVYFFLFG 244
            :.|.:...||:.:.::|.    .:::|..|:.  |.|:|..:..::...:.|.|..|...:.|..
Human   185 VFQHVSLMTLDTIMKSAFSHQGSIQVDRNSQS--YIQAISDLNSLVFCCMRNAFHENDTIYSLTS 247

  Fly   245 DYRKQVNNLKIAHEFSSNIIEKRRSLFKSNQLGQEDEFGKKQRYAMLD----TLLAAEADGQI-D 304
            ..|......::||:.:..:|:.|::     ||.:|.|..|.:|...||    .|||...:|.| .
Human   248 AGRWTHRACQLAHQHTDQVIQLRKA-----QLQKEGELEKIKRKRHLDFLDILLLAKMENGSILS 307

  Fly   305 HQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEIKYLPDDSDDISVFQFNELVYM 369
            .:.:..||:||||||:|||::.:.:.|..||.|...|::|.|||..|..|...|:....:::.|.
Human   308 DKDLRAEVDTFMFEGHDTTASGISWILYALATHPKHQERCREEIHGLLGDGASITWNHLDQMPYT 372

  Fly   370 ECVIKESLRLFPSVPFIGRRCVEEGVV--NGLIMPKNTQINIHLYEIMRDARHFSNPKMFQPDRF 432
            ...|||:|||:|.||.|||. :...|.  :|..:||...:.:.:|.:..:.:.:.|.::|.|.||
Human   373 TMCIKEALRLYPPVPGIGRE-LSTPVTFPDGRSLPKGIMVLLSIYGLHHNPKVWPNLEVFDPSRF 436

  Fly   433 FPENTVNRHPFAFVPFSAGQRNCIGQKFAILEIKVLLAAVIRNFKILPVTLLDDLTFENGIVLRT 497
            .|.:.  :|..||:|||.|.|||||::||:.::||..|..:..|::||......:.... :||::
Human   437 APGSA--QHSHAFLPFSGGSRNCIGKQFAMNQLKVARALTLLRFELLPDPTRIPIPMAR-LVLKS 498

  Fly   498 KQNIKVKL 505
            |..|.::|
Human   499 KNGIHLRL 506

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 121/396 (31%)
CYP4A22NP_001010969.2 p450 52..505 CDD:278495 121/395 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154849
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.