DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac2 and Cyp46a1

DIOPT Version :9

Sequence 1:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_034140.1 Gene:Cyp46a1 / 13116 MGIID:1341877 Length:500 Species:Mus musculus


Alignment Length:410 Identity:103/410 - (25%)
Similarity:194/410 - (47%) Gaps:46/410 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 FHAPMYNIVRAEEAEEILQSSKLITKNMIYELLKPFLGE-----GLLISTDQ-KWHSRRKALTPA 150
            |:.....:...|..::.|.|:|....:.:|..|:...||     ||:...|. :|:.:||.:..|
Mouse    80 FYKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECDYGRWYKQRKVMDLA 144

  Fly   151 FHFKVLQSFLIIFKEECNKLVKVLHQSVNME--LELNQVIPQFTLNNVCETALGVKLD------- 206
            |....|.|.:..|.|:..:||::|....:.:  :.:..::...|::.:.:.|.|::..       
Mouse   145 FSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTCATIDILAKAAFGMETSMLLGAQK 209

  Fly   207 DLSEGIRYRQSIHAIEEVMQQRLCNPFFYNIVYFFLFGDYRKQV----NNLKIAHEFSSNIIEKR 267
            .||:.::.     .:|.:...|       |.:..|:.|. |||:    .::::..:...:.:::|
Mouse   210 PLSQAVKV-----MLEGISASR-------NTLAKFMPGK-RKQLREIRESIRLLRQVGKDWVQRR 261

  Fly   268 RSLFKSNQLGQEDEFGKKQRYAMLDTLLAAEADGQIDHQGICDEVNTFMFEGYDTTSTCLIFTLL 332
            |...|.         |:.....:|..:|.|| :|..|.:.:.|...||...|::|::..|.||::
Mouse   262 REALKR---------GEDMPADILTQILKAE-EGAQDDEVLLDNFVTFFIAGHETSANHLAFTVM 316

  Fly   333 MLALHEDVQKKCYEEIKYLPDDSDDISVFQFNELVYMECVIKESLRLFPSVPFIGRRCVEEGVVN 397
            .|:...::..:...|:..:......:.......|.|:..|:||||||:|......|...||.:::
Mouse   317 ELSRQPEIVARLQAEVDEVVGSKRHLDYEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLID 381

  Fly   398 GLIMPKNTQINIHLYEIMRDARHFSNPKMFQPDRFFPENTVNRHPFAFVPFSAGQRNCIGQKFAI 462
            |:.:|.||.:....|.:.|...:|.:|..|.||||.|.....|  |.:.|||.|.|:||||:||.
Mouse   382 GVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPR--FTYFPFSLGHRSCIGQQFAQ 444

  Fly   463 LEIKVLLAAVIR--NFKILP 480
            :|:||::|.:::  .|:::|
Mouse   445 MEVKVVMAKLLQRIEFRLVP 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 103/410 (25%)
Cyp46a1NP_034140.1 p450 34..466 CDD:278495 103/410 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.