DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac2 and Cyp3a13

DIOPT Version :9

Sequence 1:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster
Sequence 2:NP_031845.1 Gene:Cyp3a13 / 13113 MGIID:88610 Length:503 Species:Mus musculus


Alignment Length:401 Identity:102/401 - (25%)
Similarity:203/401 - (50%) Gaps:36/401 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 LGEGLLISTDQKWHSRRKALTPAFHFKVLQSFLIIFKEECNKLVKVLHQSV--NMELELNQVIPQ 190
            |.:.:.||.:::|...|..|:|.|....|:....|..:..:.||:.:.|.:  .....:..:...
Mouse   114 LKKAISISENEEWKRIRALLSPTFTSGRLKEMFPIINQFTDVLVRNMRQGLGEGKPTSMKDIFGA 178

  Fly   191 FTLNNVCETALGVKLDDLSEGIRYRQSIHAIEEVMQQRLCNPFFYNIVYF-FLFGDYRKQVNNLK 254
            ::::.:..|:.||.:|.|:.  .....:..|:::::..:.:|.|.::..| ||...:  ...|:.
Mouse   179 YSMDVITATSFGVNIDSLNN--PQDPFVEKIKKLLKFDIFDPLFLSVTLFPFLTPVF--DALNVS 239

  Fly   255 I----AHEFSSNIIEKRRSLFKSNQLGQEDEFGKKQRYAMLDTLLAAE-----------ADGQID 304
            :    ...|.:..:|:    .|.|::.:::    |||...|..::.::           :|.:|.
Mouse   240 LFPRDVISFFTTSVER----MKENRMKEKE----KQRVDFLQLMINSQNYKTKESHKALSDVEIV 296

  Fly   305 HQGICDEVNTFMFEGYDTTSTCLIFTLLMLALHEDVQKKCYEEIKYLPDDSDDISVFQFNELVYM 369
            .|.:     .|:|.||:|||:.|.|.|.:||:|.|||||..:||.....:....:.....::.|:
Mouse   297 AQSV-----IFIFAGYETTSSALSFALYLLAIHPDVQKKLQDEIDAALPNKAPATYDTLLQMEYL 356

  Fly   370 ECVIKESLRLFPSVPFIGRRCVEEGVVNGLIMPKNTQINIHLYEIMRDARHFSNPKMFQPDRFFP 434
            :.|:.|:|||:|....:.|.|..:..:|||.:||.|.:.|..:.:.:|.:::..|:.|:|:||..
Mouse   357 DMVVNETLRLYPIAGRLERVCKTDVEINGLFIPKGTVVMIPTFALHKDPKYWPEPEEFRPERFSK 421

  Fly   435 ENTVNRHPFAFVPFSAGQRNCIGQKFAILEIKVLLAAVIRNFKILPVTLLD-DLTFENGIVLRTK 498
            :|..:.:|:.::||.:|.|||||.:||::.:||.|..|::||.:.|....: .|......:|:.:
Mouse   422 KNQDSINPYMYLPFGSGPRNCIGMRFALINMKVALVRVLQNFTVQPCKETEIPLKLSKQGLLQPE 486

  Fly   499 QNIKVKLVHRE 509
            ..:.:|:|.|:
Mouse   487 NPLLLKVVSRD 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 99/395 (25%)
Cyp3a13NP_031845.1 p450 39..491 CDD:365848 99/393 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.