DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac2 and LOC1272070

DIOPT Version :10

Sequence 1:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_310940.6 Gene:LOC1272070 / 1272070 VectorBaseID:AGAMI1_004112 Length:552 Species:Anopheles gambiae


Alignment Length:160 Identity:35/160 - (21%)
Similarity:57/160 - (35%) Gaps:52/160 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   853 LRVLRL--DGNRLVTMPLFQLQAAQGNLQALQSLSLGRNPWSCRCRFLPELTAFVADNAVIVQDP 915
            ||.|.|  :|:|     ||.:|......:..:.|     |....|.: |.|.|.::...|:..||
Mosquito   181 LRWLCLYPEGSR-----LFLIQKRNSEFEKKRGL-----PPLTNCAY-PRLGAALSAIKVLGPDP 234

  Fly   916 QDVYCADDGVHRELDFNVSAACSDFYAGRSVLP-----------GDGLPETYIMLMALAVVLVCL 969
            .:...:::|....|::.|.....  |...::||           |.|.|                
Mosquito   235 NNPLKSNNGKGPPLEYLVDVTLG--YPDGNILPLNEIFMSAWRNGGGKP---------------- 281

  Fly   970 LLLAVLMFVFR--------EPLRFWLFSRY 991
              .|:...:|:        |.|:.:||.||
Mosquito   282 --FAIHYEIFKMDPKWKDEEELKNFLFDRY 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac2NP_608917.3 CYP4 84..503 CDD:410721
LOC1272070XP_310940.6 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.