DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac2 and LOC103692784

DIOPT Version :9

Sequence 1:NP_608917.3 Gene:Cyp4ac2 / 33755 FlyBaseID:FBgn0031694 Length:511 Species:Drosophila melanogaster
Sequence 2:XP_038935978.1 Gene:LOC103692784 / 103692784 RGDID:9252969 Length:337 Species:Rattus norvegicus


Alignment Length:331 Identity:101/331 - (30%)
Similarity:164/331 - (49%) Gaps:30/331 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 IPQFTLNNVCETALGVKLDDLSEGIRYRQSIHAIEEVMQQRLCNPFFYNIVYFFLFGDYRKQVNN 252
            |...||:::.:...|...:.......|..:|..:..:..:|....|.|....::...|.|:....
  Rat     5 ISLMTLDSLQKCLFGFDSNCQESPSEYISAILELSSLTIKRSYQLFLYLDFLYYRTADGRRFRKA 69

  Fly   253 LKIAHEFSSNIIEKRRSLFKSNQLGQEDEF------GKKQRYAMLDTLLAA--EADGQIDHQGIC 309
            ..:.|.|:..:|.:||.|..|..:   |||      .|.:....:|.||.|  |...::..:.|.
  Rat    70 CDLVHSFTDAVIRERRRLLSSQGV---DEFLESKTKSKSKTLDFIDVLLLAKDEHGKELSDEDIR 131

  Fly   310 DEVNTFMF--EGYDTTSTCLIFTLLMLALHEDVQKKCYEEI-KYLPD-DSDDISVFQFNELVYME 370
            .|.:||||  |.:|||::.|.:.|..||.|.:.|:.|.:|: :.|.| :.::|......:|.::.
  Rat   132 AEADTFMFGDESHDTTASTLSWILYNLARHPEYQESCLQEVWELLRDREPEEIEWDDLAQLPFLT 196

  Fly   371 CVIKESLRLFPSVPFIGRRCVEEGVV-NGLIMPKNTQINIHLYEIMRDARHFSNPKMFQPDRFFP 434
            ..|||||||.|....:.|||.::.|: :|.::||.....|.::.|..:...:.:|:::.|.||.|
  Rat   197 MCIKESLRLHPPAVDLLRRCTQDIVLPDGRVIPKGNICVISIFGIHHNPSVWPDPEVYDPFRFDP 261

  Fly   435 ENTVNRHPFAFVPFSAGQRNCIGQKFAILEIKVLLAAVIRNFKILPVTLLDD----------LTF 489
            |:...|.|.:|:|||||.||||||.||:.|:||.:|..:..|::||    ||          |..
  Rat   262 ESRQKRSPLSFIPFSAGPRNCIGQTFAMNEMKVAVALTLLRFRLLP----DDKEPRRKPEIILRA 322

  Fly   490 ENGIVL 495
            |.|:.|
  Rat   323 EGGLRL 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac2NP_608917.3 p450 57..505 CDD:278495 101/331 (31%)
LOC103692784XP_038935978.1 cytochrome_P450 <1..328 CDD:425388 100/329 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.