DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ac1 and CYP72A11

DIOPT Version :10

Sequence 1:NP_608916.1 Gene:Cyp4ac1 / 33754 FlyBaseID:FBgn0031693 Length:509 Species:Drosophila melanogaster
Sequence 2:NP_188083.1 Gene:CYP72A11 / 820693 AraportID:AT3G14650 Length:512 Species:Arabidopsis thaliana


Alignment Length:65 Identity:15/65 - (23%)
Similarity:30/65 - (46%) Gaps:5/65 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QHKGLNKEHLVLLRDGDFSKVDADTKCFLRCFLQQANFMDAAGKLQND-YVIERLSLNREKSKVE 100
            ||...|:.||    |.:.:|.:.|.:..:..:|.|...::.......| |::..:::..||..:|
plant   207 QHLEKNQAHL----DQEHTKKNQDGQDGILEYLTQGQQLENPNLQHLDRYLVTEVTMEHEKQNLE 267

  Fly   101  100
            plant   268  267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ac1NP_608916.1 CYP4 83..502 CDD:410721 5/19 (26%)
CYP72A11NP_188083.1 CYP72 82..508 CDD:410735 15/65 (23%)

Return to query results.
Submit another query.