DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tkv and ACVRL1

DIOPT Version :9

Sequence 1:NP_787990.1 Gene:tkv / 33753 FlyBaseID:FBgn0003716 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_000011.2 Gene:ACVRL1 / 94 HGNCID:175 Length:503 Species:Homo sapiens


Alignment Length:494 Identity:226/494 - (45%)
Similarity:294/494 - (59%) Gaps:45/494 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 LTCYCDGSCPDNVSNGTCETRPGGSCFSAVQQLYDETTGMYEEERTYGCMPPEDNG-GFL---MC 141
            :||.|:.   .:....||.   |..|          |..:..||   |..|.|..| |.|   :|
Human    32 VTCTCES---PHCKGPTCR---GAWC----------TVVLVREE---GRHPQEHRGCGNLHRELC 77

  Fly   142 KVAAVPHLHGKNIVCCDKEDFCNRDLYPTYTPKLTTPAPDLPVSSESLHTLAVFGSIIISLSVFM 206
            :......:   |..|||.. .||.::  :...:.|.|..:.|.:...|  ..:.|.::..|::..
Human    78 RGRPTEFV---NHYCCDSH-LCNHNV--SLVLEATQPPSEQPGTDGQL--ALILGPVLALLALVA 134

  Fly   207 LIVASLCFTYKRREKLR------KQPRLINSMCNSQLSPLSQLVEQ--SSGSGSGLPLLVQRTIA 263
            |.|..|....:|:||.|      .:..||........|.|..|::.  ::|||||||.|||||:|
Human   135 LGVLGLWHVRRRQEKQRGLHSELGESSLILKASEQGDSMLGDLLDSDCTTGSGSGLPFLVQRTVA 199

  Fly   264 KQIQMVRLVGKGRYGEVWLAKWRDERVAVKTFFTTEEASWFRETEIYQTVLMRHDNILGFIAADI 328
            :|:.:|..||||||||||...|..|.||||.|.:.:|.|||||||||.|||:||||||||||:|:
Human   200 RQVALVECVGKGRYGEVWRGLWHGESVAVKIFSSRDEQSWFRETEIYNTVLLRHDNILGFIASDM 264

  Fly   329 KGNGSWTQMLLITDYHEMGSLHDYLSMSVINPQKLQLLAFSLASGLAHLHDEIFGTPGKPAIAHR 393
            ....|.||:.|||.|||.|||:|:|....:.|.....||.|.|.||||||.|||||.||||||||
Human   265 TSRNSSTQLWLITHYHEHGSLYDFLQRQTLEPHLALRLAVSAACGLAHLHVEIFGTQGKPAIAHR 329

  Fly   394 DIKSKNILVKRNGQCAIADFGLAVKYNSELDVIHIAQNPRVGTRRYMAPEVLSQQLDPKQFEEFK 458
            |.||:|:|||.|.||.|||.||||.::...|.:.|..||||||:||||||||.:|:....||.:|
Human   330 DFKSRNVLVKSNLQCCIADLGLAVMHSQGSDYLDIGNNPRVGTKRYMAPEVLDEQIRTDCFESYK 394

  Fly   459 RADMYSVGLVLWEMTRRCYTPVSGTKTTTCEDYALPYHDVVPSDPTFEDMHAVVCVKGFRPPIPS 523
            ..|:::.||||||:.||  |.|:|    ..|||..|::||||:||:||||..||||....|.||:
Human   395 WTDIWAFGLVLWEIARR--TIVNG----IVEDYRPPFYDVVPNDPSFEDMKKVVCVDQQTPTIPN 453

  Fly   524 RWQEDDVLATVSKIMQECWHPNPTVRLTALRVKKTLGRL 562
            |...|.||:.::::|:|||:|||:.||||||:||||.::
Human   454 RLAADPVLSGLAQMMRECWYPNPSARLTALRIKKTLQKI 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tkvNP_787990.1 Activin_recp 81..171 CDD:279413 23/93 (25%)
GS 238..266 CDD:197743 16/29 (55%)
S_TKc 267..557 CDD:214567 167/289 (58%)
STKc_BMPR1 270..562 CDD:271046 170/291 (58%)
ACVRL1NP_000011.2 Mediates specificity for BMP ligand 73..76 0/2 (0%)
TGF_beta_GS 173..200 CDD:312125 14/26 (54%)
STKc_ACVR1_ALK1 196..493 CDD:271044 175/303 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144583
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D338017at33208
OrthoFinder 1 1.000 - - FOG0000203
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X151
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.