DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tkv and wit

DIOPT Version :9

Sequence 1:NP_787990.1 Gene:tkv / 33753 FlyBaseID:FBgn0003716 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001261395.1 Gene:wit / 44096 FlyBaseID:FBgn0024179 Length:913 Species:Drosophila melanogaster


Alignment Length:544 Identity:139/544 - (25%)
Similarity:223/544 - (40%) Gaps:95/544 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 EGYEDADNE-KSKTVENARSLTCYCDGSCPDNVSNGTCETRPGG--SCFSAVQQLYDETT----- 118
            :|.:|:..| :.:.||:.         ..|......||   |.|  .||:    ::::|.     
  Fly    41 DGDQDSSGELQEQQVEST---------PIPSEPHRRTC---PDGYTFCFT----IWNQTANGARV 89

  Fly   119 ---GMYEE--ERTYGCMPPEDNGGFLMCKVAAVPHLHGKNIVCCDKEDFCNRDLYPTYTP----- 173
               |.:::  :||..|...|       |..:|..........||.....||.. |....|     
  Fly    90 VKQGCWKDNTDRTSICSQSE-------CTSSAPTSKTSSLYYCCCSGGVCNAQ-YSVVEPAPLEL 146

  Fly   174 -------KLTTPAPDLPVSSESLHTLAVFGSIIISLSVFMLIVASLCFTYKRREKLRKQPRLINS 231
                   .:|..|.:....|....|:......:.:|::.:.:....|.|.|.:.:..:.|     
  Fly   147 GSNEGRTSITNRATEKQHQSFLASTMLGLAGGLTALTIGIFLAVQYCRTAKEKPEPEESP----- 206

  Fly   232 MCNSQLSPLSQLVEQSSGSGSGLPLLVQRTIAKQIQMVRLVGKGRYGEVWLAKWRDERVAVKTFF 296
                 |:|        ||.|....|   |.: ..:.::.::|.|:||.|......|:.||||.:.
  Fly   207 -----LAP--------SGPGYSSNL---RNV-DNMNLIGMLGSGKYGTVMKGLLHDQEVAVKIYP 254

  Fly   297 TTEEASWFRETEIYQTVLMRHDNILGFIAAD----IKGNGSWTQMLLITDYHEMGSLHDYLSMSV 357
            ......:..|..||...||....:|.:...|    :.|.   .:..|:.....:|.|.|:|..:.
  Fly   255 EEHHQYYVNERNIYALPLMECPALLSYFGYDERCTMDGR---MEYQLVLSLAPLGCLQDWLIANT 316

  Fly   358 INPQKLQLLAFSLASGLAHLHDEI-FGTPGKPAIAHRDIKSKNILVKRNGQCAIADFGLAVK--- 418
            :...:...:..|:..|::|||.|: .|...||.:|||||.::|:||:.:..|.|||||.|:|   
  Fly   317 LTFSECCGMLRSITRGISHLHTELRLGDQHKPCVAHRDINTRNVLVQADLSCCIADFGFALKVFG 381

  Fly   419 ----YNSELDVIHIAQNPRVGTRRYMAPEVLSQQLDPKQFE-EFKRADMYSVGLVLWEMTRRC-- 476
                |..|:.:........|||.||||||:|...::.:..| ..|:.|:|::||||||:..||  
  Fly   382 SKYEYKGEVAMAETKSINEVGTLRYMAPELLEGAVNLRDCETSLKQMDVYALGLVLWEVATRCSD 446

  Fly   477 -YTPVSGTKTTTCEDYALPYHDVVPSDPTFEDMHAVVCVKGFRPPIPSRWQEDDVLATVSKIMQE 540
             |.|...|     ..|..||...|.|.|:|:.|.|:|.....||..|:.|........|....::
  Fly   447 FYAPGQAT-----PPYKAPYEQEVGSHPSFDQMQALVVRHKARPLFPTGWGGGAAAKVVRDTCED 506

  Fly   541 CWHPNPTVRLTALRVKKTLGRLET 564
            ||..:...|||:|..::.:..:.|
  Fly   507 CWDHDADARLTSLCAEERMQEMST 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tkvNP_787990.1 Activin_recp 81..171 CDD:279413 20/101 (20%)
GS 238..266 CDD:197743 6/27 (22%)
S_TKc 267..557 CDD:214567 96/305 (31%)
STKc_BMPR1 270..562 CDD:271046 96/307 (31%)
witNP_001261395.1 snake_toxin 57..133 CDD:264434 17/98 (17%)
STYKc 226..517 CDD:214568 93/298 (31%)
STKc_BMPR2_AMHR2 228..528 CDD:270956 96/307 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445039
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23255
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.