DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tkv and Tgfbr1

DIOPT Version :9

Sequence 1:NP_787990.1 Gene:tkv / 33753 FlyBaseID:FBgn0003716 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_006238092.2 Gene:Tgfbr1 / 29591 RGDID:3852 Length:501 Species:Rattus norvegicus


Alignment Length:500 Identity:237/500 - (47%)
Similarity:306/500 - (61%) Gaps:48/500 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ARSLTCYCDGSCPDNVSNGTCETRPGGSCFSAVQQLYDET---------TGMYEEERTYGCMPPE 133
            |::|.|:|.....||.   ||||  .|.||.:|.:..|:.         ..:...:|.:.|.|..
  Rat    27 AKALQCFCHLCTKDNF---TCET--DGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSS 86

  Fly   134 DNGGFLMCKVAAVPHLHGKNIVCCDKEDFCNRDLYPTYTPKLTTPAPDL-PVSSESLHTLAVFGS 197
                    |..||.:       ||: :|.||:...||..|.....:..| ||     ...||...
  Rat    87 --------KTGAVTY-------CCN-QDHCNKIELPTTGPFSEKQSAGLGPV-----ELAAVIAG 130

  Fly   198 IIISLSVFMLIVASLCF---TYKRREKLRKQPRLINSMCNSQLSPLSQLVEQ--SSGSGSGLPLL 257
            .:..:.:.::::..:|.   ....|....:.|.|..... |:.:.|..|:..  :||||||||||
  Rat   131 PVCFVCIALMLMVYICHNRTVIHHRVPNEEDPSLDRPFI-SEGTTLKDLIYDMTTSGSGSGLPLL 194

  Fly   258 VQRTIAKQIQMVRLVGKGRYGEVWLAKWRDERVAVKTFFTTEEASWFRETEIYQTVLMRHDNILG 322
            ||||||:.|.:...:||||:||||..|||.|.||||.|.:.||.|||||.||||||::||:||||
  Rat   195 VQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILG 259

  Fly   323 FIAADIKGNGSWTQMLLITDYHEMGSLHDYLSMSVINPQKLQLLAFSLASGLAHLHDEIFGTPGK 387
            |||||.|.||:|||:.|::||||.|||.|||:...:..:.:..||.|.||||||||.||.||.||
  Rat   260 FIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGK 324

  Fly   388 PAIAHRDIKSKNILVKRNGQCAIADFGLAVKYNSELDVIHIAQNPRVGTRRYMAPEVLSQQLDPK 452
            |||||||:||||||||:||.|.|||.||||:::|..|.|.||.|.||||:||||||||...::.|
  Rat   325 PAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMK 389

  Fly   453 QFEEFKRADMYSVGLVLWEMTRRCYTPVSGTKTTTCEDYALPYHDVVPSDPTFEDMHAVVCVKGF 517
            .||.|||||:|::|||.||:.|||  .:.|..    |||.|||:|:|||||:.|:|..|||.:..
  Rat   390 HFESFKRADIYAMGLVFWEIARRC--SIGGIH----EDYQLPYYDLVPSDPSVEEMRKVVCEQKL 448

  Fly   518 RPPIPSRWQEDDVLATVSKIMQECWHPNPTVRLTALRVKKTLGRL 562
            ||.||:|||..:.|..::|||:|||:.|...||||||:||||.:|
  Rat   449 RPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQL 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tkvNP_787990.1 Activin_recp 81..171 CDD:279413 26/98 (27%)
GS 238..266 CDD:197743 18/29 (62%)
S_TKc 267..557 CDD:214567 174/289 (60%)
STKc_BMPR1 270..562 CDD:271046 178/291 (61%)
Tgfbr1XP_006238092.2 Activin_recp 30..108 CDD:279413 26/98 (27%)
TGF_beta_GS 174..201 CDD:285687 17/26 (65%)
Pkinase_Tyr 203..490 CDD:285015 177/292 (61%)
STKc_TGFbR1_ACVR1b_ACVR1c 207..494 CDD:271045 178/292 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D338017at33208
OrthoFinder 1 1.000 - - FOG0000203
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X151
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.