DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC25D and CAM7

DIOPT Version :10

Sequence 1:NP_608915.2 Gene:TpnC25D / 33752 FlyBaseID:FBgn0031692 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_001326523.1 Gene:CAM7 / 823492 AraportID:AT3G43810 Length:214 Species:Arabidopsis thaliana


Alignment Length:143 Identity:49/143 - (34%)
Similarity:95/143 - (66%) Gaps:3/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DEKMDIMRKAFQMFDTQKTGFIETLRLKTILNSMGQMFDDSELQALIDDNDPEDTGKVNFDGFCS 68
            |:::...::||.:||....|.|.|..|.|::.|:||...::|||.:|::.|.:..|.::|..|.:
plant     7 DDQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLN 71

  Fly    69 IAAHFLEEEDAEAIQKELKEAFRLYDREGNGYITTSTLKEILAALDDKLSSSDLDGIIAEIDTDG 133
            :.|..:::.|:|   :|||||||::|::.||:|:.:.|:.::..|.:||:..::|.:|.|.|.||
plant    72 LMARKMKDTDSE---EELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDG 133

  Fly   134 SGTVDFDEFMEMM 146
            .|.::::||:::|
plant   134 DGQINYEEFVKVM 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC25DNP_608915.2 PTZ00184 4..146 CDD:185504 48/141 (34%)
CAM7NP_001326523.1 PTZ00184 1..149 CDD:185504 49/143 (34%)

Return to query results.
Submit another query.