DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TpnC25D and cal-3

DIOPT Version :10

Sequence 1:NP_608915.2 Gene:TpnC25D / 33752 FlyBaseID:FBgn0031692 Length:149 Species:Drosophila melanogaster
Sequence 2:NP_500421.2 Gene:cal-3 / 177143 WormBaseID:WBGene00000287 Length:234 Species:Caenorhabditis elegans


Alignment Length:144 Identity:41/144 - (28%)
Similarity:82/144 - (56%) Gaps:4/144 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DEKMDIMRKAFQMFDTQKTGFIETLRLKTILNSMGQMFDDSELQALIDDNDPEDTGKVNFDGFCS 68
            :|::...::||.:||....|.|....|...:.::||...:.::..:|.|.|.:..|:|.|..||.
 Worm    95 EEEIHEFKEAFLLFDKDGNGTISIKELGVAMRALGQNPTEQQMMEIIHDVDLDGNGQVEFPEFCV 159

  Fly    69 IAAHFLEEEDAEAIQKELKEAFRLYDREGNGYITTSTLKEILAALDDKLSSSDLDGIIAEIDTDG 133
            :....::|.|:|.|    :|||:::||:|||.||.:..|..:..:.......:::.::.|:|.||
 Worm   160 MMKRIMKETDSEMI----REAFKIFDRDGNGVITANEFKLFMINMGMCFDEVEVEEMMNEVDCDG 220

  Fly   134 SGTVDFDEFMEMMA 147
            :|.:|::||:::.:
 Worm   221 NGEIDYEEFVKIFS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TpnC25DNP_608915.2 PTZ00184 4..146 CDD:185504 41/141 (29%)
cal-3NP_500421.2 PTZ00184 92..232 CDD:185504 41/140 (29%)

Return to query results.
Submit another query.