DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and CG34447

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001097060.1 Gene:CG34447 / 5740813 FlyBaseID:FBgn0085476 Length:389 Species:Drosophila melanogaster


Alignment Length:329 Identity:137/329 - (41%)
Similarity:189/329 - (57%) Gaps:5/329 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILVLIGFS-SVMLVAGLDDMNCFSLQNEICPNANISFWLYTKENQEG-TKLSVFELNRFEFYHHK 67
            :|.||..| |...:.||.|..|..::.| |||.|||||||:...:|. ..|...:||.:.|...:
  Fly     9 LLTLIWRSASANPILGLFDPACQVVRGE-CPNKNISFWLYSNSTRENPILLDPLDLNPWNFQPPR 72

  Fly    68 PLKVLIHGFNGHRDFSPNTQLRPLFLT-QDYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLL 131
            |||:||||:.|.|||:||:.:||:.|. :|..:||:||..|...|||.:||.|...|:||.|||:
  Fly    73 PLKILIHGYTGDRDFAPNSYIRPVLLDHEDVYVISIDYGPLVRYPCYIQAVQNLPLVSRCLAQLI 137

  Fly   132 RVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDA 196
            ..|::..:|..:.:||||..||..|||....:: :.|::.||.||||||.:::...:.:||..||
  Fly   138 NNLVDRAIVANDQIHLIGFSLGGQVAGQTANYV-KRKMKRITGLDPAKPLFILGPDSRRLDKGDA 201

  Fly   197 KFVDVVHTDVTMLGLLDAVGHVDFYLNMGVSQPNCGPINKMETHFCYHNRAADYYAESISSPSGF 261
            .||||:||||...|.|.|.||||||.|.|..||.|...|..:...|.|.||..:|||||::..||
  Fly   202 DFVDVIHTDVFGRGYLRAAGHVDFYPNFGAKQPGCMEENMQDPSSCNHERAPRFYAESINTTVGF 266

  Fly   262 YGFYCPNFKSFAKGICIPDKNIELMGFHVDPKARGRYFLDTNNGPPYAKGENFTSISRQLKGRTF 326
            :...|..:......:|.......|:|:||..:.||.|||.|.:..|||.|:.....:||...:..
  Fly   267 WARQCSGWLLQLLTLCPTTGAQALLGYHVSDELRGSYFLQTASKSPYALGKMQDVDNRQTLAKFH 331

  Fly   327 VNDD 330
            :|.|
  Fly   332 LNFD 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 115/267 (43%)
CG34447NP_001097060.1 Pancreat_lipase_like 41..309 CDD:238363 116/268 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438292
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EB09
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D139550at50557
OrthoFinder 1 1.000 - - FOG0008540
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.