DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and PNLIPRP1

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001290064.1 Gene:PNLIPRP1 / 5407 HGNCID:9156 Length:467 Species:Homo sapiens


Alignment Length:354 Identity:114/354 - (32%)
Similarity:163/354 - (46%) Gaps:57/354 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DDMNCFSLQN----------EICP----NANISFWLYTKENQEGTKL------SVFELNRFEFYH 65
            :|:.|||...          :|.|    .....|.|||.||....::      |..|.:.|:.  
Human    23 EDLGCFSDTEPWGGTAIRPLKILPWSPEKIGTRFLLYTNENPNNFQILLLSDPSTIEASNFQM-- 85

  Fly    66 HKPLKVLIHGFNGHRDFSPNTQL-RPLFLTQDYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQ 129
            .:..:.:||||....|.|..|.: :.||..::.|.|.:|:.| ..:..||:|.:|.:.|....||
Human    86 DRKTRFIIHGFIDKGDESWVTDMCKKLFEVEEVNCICVDWKK-GSQATYTQAANNVRVVGAQVAQ 149

  Fly   130 LLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPT 194
            :|.:||.........:||||..|||||||..|...|  .|..||.|||.:..:......::|||:
Human   150 MLDILLTEYSYPPSKVHLIGHSLGAHVAGEAGSKTP--GLSRITGLDPVEASFESTPEEVRLDPS 212

  Fly   195 DAKFVDVVHTDVTML------GLLDAVGHVDFYLNMGVSQPNC--GPINKM-----------ETH 240
            ||.||||:|||...|      |....:||:||:.|.|.|.|.|  ..::::           :..
Human   213 DADFVDVIHTDAAPLIPFLGFGTNQQMGHLDFFPNGGESMPGCKKNALSQIVDLDGIWAGTRDFV 277

  Fly   241 FCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICI--PDKNIELMGFHVDPKARGR------ 297
            .|.|.|:..||.|||.:|.||..:.|.::|||....|.  ||:....||.:.| |..||      
Human   278 ACNHLRSYKYYLESILNPDGFAAYPCTSYKSFESDKCFPCPDQGCPQMGHYAD-KFAGRTSEEQQ 341

  Fly   298 -YFLDTNNGPPYAKGENFTSISRQLKGRT 325
             :||:|.....:|:.....||:  |.|||
Human   342 KFFLNTGEASNFARWRYGVSIT--LSGRT 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 100/300 (33%)
PNLIPRP1NP_001290064.1 Lipase 18..353 CDD:278576 107/335 (32%)
Pancreat_lipase_like 52..349 CDD:238363 101/302 (33%)
PLAT_PL 356..467 CDD:238857 6/15 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145208
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.