DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and PNLIP

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_000927.1 Gene:PNLIP / 5406 HGNCID:9155 Length:465 Species:Homo sapiens


Alignment Length:387 Identity:111/387 - (28%)
Similarity:168/387 - (43%) Gaps:78/387 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SVML--VAG----LDDMNCFSLQN----------EICP----NANISFWLYTKENQEGTKLSVFE 57
            |::|  |||    .:.:.|||..:          .|.|    :.|..|.|||.||.         
Human     8 SLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTNENP--------- 63

  Fly    58 LNRFE-------------FYHHKPLKVLIHGF--NGHRDFSPNTQLRPLFLTQDYNLISLDYPKL 107
             |.|:             |..::..:.:||||  .|..::..|. .:.||..:..|.|.:|: |.
Human    64 -NNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANV-CKNLFKVESVNCICVDW-KG 125

  Fly   108 AYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEHI 172
            .....||:|..|.:.|....|..:..|..:......::|:||..||||.||..|: .....:..|
Human   126 GSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR-RTNGTIGRI 189

  Fly   173 TALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTML------GLLDAVGHVDFYLNMGVSQPNC 231
            |.||||:|.:......::|||:|||||||:|||...:      |:...|||:||:.|.||..|.|
Human   190 TGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGHLDFFPNGGVEMPGC 254

  Fly   232 --GPINKM-----------ETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICI--PDK 281
              ..::::           :...|.|.|:..||.:||.:|.||.||.|.::..|....|.  |..
Human   255 KKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGFPCASYNVFTANKCFPCPSG 319

  Fly   282 NIELMGFHVD--PKARG----RYFLDTNNGPPYAKGENFTSISRQLKGRTFVNDDIIDKLIG 337
            ....||.:.|  |....    :::|||.:...:|:.....|::  |.|:. |...|:..|.|
Human   320 GCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVSVT--LSGKK-VTGHILVSLFG 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 92/307 (30%)
PNLIPNP_000927.1 Lipase 17..352 CDD:278576 98/347 (28%)
PLAT_PL 355..465 CDD:238857 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145219
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.