DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and lipia

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001003499.1 Gene:lipia / 445105 ZFINID:ZDB-GENE-040801-242 Length:454 Species:Danio rerio


Alignment Length:313 Identity:88/313 - (28%)
Similarity:137/313 - (43%) Gaps:61/313 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KENQEGTKLSVFELNRFEFY------------HHKPLK-----------VLIHGFNGHRDFSPNT 86
            |::..||.|.|    |...|            |.:|..           .||||:.       .|
Zfish    35 KDSLAGTSLKV----RLLLYTRADPSCGQLLSHQEPFSNSQFNVSSVTTFLIHGYR-------PT 88

  Fly    87 QLRPLFLTQ---------DYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKI 142
            ...|:::.|         |.|:|.:|:.:.|....|.:.|.|.:.||.....|::.:.::| ..:
Zfish    89 GSPPVWMKQFVEFLLNRRDMNVIVVDWNRGATNMNYWQVVKNTRKVANNLTDLIQKMKDNG-ANL 152

  Fly   143 EDLHLIGLGLGAHVAGFIG-QFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDV 206
            ..:|:||:.||||::||.| .|..|  :..|||||||.|.:..:.|..:|||:||.||:.:|||:
Zfish   153 SSIHMIGVSLGAHISGFTGANFNGE--IGRITALDPAGPEFNGRPPEDRLDPSDALFVEALHTDM 215

  Fly   207 TMLGLLDAVGHVDFYLNMGVSQPNCGP--INKMETHFCYHNRAADYYAESISSPSGFYGFYCPNF 269
            ..||..:.:||:|:|.|.|..||.|..  ::..|...|.|.|:...|..|::.......:.|.::
Zfish   216 DALGYRNLLGHIDYYANGGADQPGCPKTILSGSEYFKCDHQRSVFLYMSSVNGSCPIIAYPCESY 280

  Fly   270 KSFAKGICIPDKNIELMG---FHVD---------PKARGRYFLDTNNGPPYAK 310
            ..|..|.|:.....:..|   |..|         ...:.|.:..||...|:.|
Zfish   281 TDFQDGTCMDCGKFKSAGCPIFGYDSVRWRDTLVQLEQTRTYFQTNKASPFCK 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 84/304 (28%)
lipiaNP_001003499.1 Pancreat_lipase_like 43..327 CDD:238363 82/297 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.