DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and CG6271

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_651526.1 Gene:CG6271 / 43252 FlyBaseID:FBgn0039476 Length:341 Species:Drosophila melanogaster


Alignment Length:278 Identity:79/278 - (28%)
Similarity:140/278 - (50%) Gaps:15/278 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ISFWLYTKENQEGTK---LSVFELNRFEFYHHKPLKVLIHGFNGHRDFSPNTQLRPLFLTQ-DYN 98
            ::|:|:|.:|...:|   .:...:::..|....|.:.:|||:......|.|:.:|..||:: |||
  Fly    68 VNFYLFTPKNPSSSKHIYATTKSISKSNFNPAHPTRFVIHGWTQSYLNSMNSDIRKAFLSKGDYN 132

  Fly    99 LISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQF 163
            :|.:|:.: |....|..:|.......:..|:::..|.::..:.:.|:::||..|||||||:.|: 
  Fly   133 VIVVDWAR-ARSVDYATSVMAVAATGKKVAKMINFLKDNHGLNLNDVYVIGHSLGAHVAGYAGK- 195

  Fly   164 LPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNMGVSQ 228
            ..:.::..|..||||.|.:....|..:|:..||.:|:.:.|:...||.|..:|...||.|.|.:|
  Fly   196 NTDGQVHTIIGLDPALPLFSYNKPNKRLNSDDAWYVESIQTNGGTLGFLKPIGKGAFYPNGGKTQ 260

  Fly   229 PNCGPINKMETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICIPDKNIELMGFHVDPK 293
            |.| |::  .|..|.|.|:..||||::|. ..|....|.:::......|....:...||  .|..
  Fly   261 PGC-PLD--VTGACSHGRSTTYYAEAVSE-DNFGTMKCGDYEEAVAKECGSTYSSVRMG--ADTN 319

  Fly   294 A---RGRYFLDTNNGPPY 308
            |   .|.:::..|:..|:
  Fly   320 AYMVEGDFYVPVNSKAPF 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 77/271 (28%)
CG6271NP_651526.1 Lipase 57..337 CDD:278576 78/276 (28%)
Pancreat_lipase_like 68..333 CDD:238363 77/272 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445939
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.