DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and CG17191

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_651523.1 Gene:CG17191 / 43249 FlyBaseID:FBgn0039473 Length:337 Species:Drosophila melanogaster


Alignment Length:286 Identity:80/286 - (27%)
Similarity:134/286 - (46%) Gaps:20/286 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NISFWLYTKENQEGTKLSVFELNRFEFYH---HKPLKVLIHGFNGHRDFSPNTQLRPLFLTQ-DY 97
            ::||:||||.|....|....:.:..|..|   ::..:.:|||:||......|.::...:|:: ||
  Fly    62 DVSFYLYTKHNPTVGKEIRADASSIEDSHFDKNQGTRFVIHGWNGRYTDGMNVKITRAWLSKGDY 126

  Fly    98 NLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQ 162
            |:|.:::.: |....|..:|...........:::..|.|...:.:|.|.:||..|||||||:.|:
  Fly   127 NVIVVNWDR-AQSVDYISSVRAVPGAGAKVGEMIEYLHEHHHLSMESLEVIGHSLGAHVAGYAGK 190

  Fly   163 FLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNMGVS 227
            .:...::..|..||||.|.:....|..:|...||.:|:.:.|:....|.|..:|...||.|.|.:
  Fly   191 QVGGKRVHTIVGLDPAMPLFAYDKPDKRLSTEDAFYVESIQTNGGEKGFLKPIGKGTFYPNGGRN 255

  Fly   228 QPNCG-PINKMETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICIPDKNIELMG---- 287
            ||.|| .|...    |.|.|:..||.|:::. ..|....|.::::.....|....:...||    
  Fly   256 QPGCGSDIGGT----CAHGRSVTYYVEAVTE-DNFGTIKCHDYQAALANECGSTYSGVRMGAVTN 315

  Fly   288 -FHVDPKARGRYFLDTNNGPPYAKGE 312
             :.||    |.:::..|...|:.|.|
  Fly   316 AYMVD----GDFYVPVNGQAPFGKIE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 76/275 (28%)
CG17191NP_651523.1 Pancreat_lipase_like 62..328 CDD:238363 76/275 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445942
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.