DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and CG17192

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_651522.1 Gene:CG17192 / 43248 FlyBaseID:FBgn0039472 Length:337 Species:Drosophila melanogaster


Alignment Length:345 Identity:86/345 - (24%)
Similarity:160/345 - (46%) Gaps:56/345 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FSSVMLVAG--------------------------LDDMNCFSLQNEICP----NANISFWLYTK 45
            |.:.:||||                          :|..:...|...|.|    :..:||:||||
  Fly     6 FLAALLVAGNALPIEERINGENGWFVPQEDGTFQWMDKKDAKELLENISPLEFRSNEVSFYLYTK 70

  Fly    46 EN-QEGTKLSVFELNRFEFYHHKP--LKVLIHGFNGHRDFSPNTQLRPLFLTQ-DYNLISLDYPK 106
            :| .||.:::....:....:.:|.  .:.:|||:.|....|.|..:...:|:: |:|:|.:::.:
  Fly    71 QNPTEGQEITADASSIVASHFNKDHGTRFVIHGWKGKYTDSMNVDITKAWLSKGDFNVIVVNWAR 135

  Fly   107 LAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEH 171
             :....|..:|...........::::.:.|:..:.:|.|.:||..|||||||:.|:.:.:.::..
  Fly   136 -SQSVDYAMSVRAVPGAGTKVGEMIQYMHENHDMSLETLEVIGHSLGAHVAGYAGKQVGQKRVHT 199

  Fly   172 ITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNMGVSQPNCGPINK 236
            |..||||.|.:...:|..:|...||.:|:.:.|:..:.|.:..:|...||::.|..||.|| ::.
  Fly   200 IVGLDPALPLFSYDNPDKRLSSEDAFYVESIQTNGGVKGFVKPIGKAAFYVSGGRKQPGCG-VDL 263

  Fly   237 METHFCYHNRAADYYAESISSPSGFYGFYCPNFK---------SFAKGICIPDKNIELMGFHVDP 292
            ..|  |.|.|:..||||:|:..| |....|.:::         ||:......|.|    .::|: 
  Fly   264 AGT--CSHARSVIYYAEAITENS-FGAIQCQDYQAALDNECGSSFSSVRMAEDTN----AYNVE- 320

  Fly   293 KARGRYFLDTNNGPPYAKGE 312
               |.:::..|:..|:.:.|
  Fly   321 ---GHFYVPVNSEAPFGQTE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 74/278 (27%)
CG17192NP_651522.1 Lipase 55..333 CDD:278576 76/290 (26%)
Pancreat_lipase_like 62..329 CDD:238363 74/279 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445943
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.