DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and CG6296

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_651520.1 Gene:CG6296 / 43246 FlyBaseID:FBgn0039470 Length:676 Species:Drosophila melanogaster


Alignment Length:295 Identity:85/295 - (28%)
Similarity:140/295 - (47%) Gaps:19/295 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SLQNEICPNANISFWLYTKENQ---EGTKLSVFELNRFEFYHHKPLKVLIHGFNGHRDFSPNTQL 88
            :|:..:..| .::|:|||.:|.   :..|.:...::...|....|.::.|||:|.:.....||::
  Fly    61 ALEGRLSTN-TVNFYLYTLQNPSTGQQIKATQDSIDGSFFNPQNPTRITIHGWNSNYKDGVNTRV 124

  Fly    89 RPL-FLTQDYNLISLDYPK-LAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLG 151
            ... |...|||:|::|:.: .:.|  |..:|..|....:..|.|:..|:|...:.::.|.::|..
  Fly   125 ADAWFQYGDYNMIAVDWLRGRSLE--YASSVAGAPGAGKKVAALVDFLVEGYGMSLDTLEIVGFS 187

  Fly   152 LGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVG 216
            |||||||...:.:...|:..:..||||.|.....:...:|...||.:|:.:.|:..:||....:|
  Fly   188 LGAHVAGHTAKQVNSGKVGKVVGLDPASPLISYSNTEKRLSSDDALYVESIQTNGAILGFGQPIG 252

  Fly   217 HVDFYLNMGVSQPNCGPINKMETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICIPDK 281
            ...||:|.|.|||.|| |:  .|..|.|.:|..||.|::.. :.|....|.:.....|..|....
  Fly   253 KASFYMNGGRSQPGCG-ID--ITGSCSHTKAVLYYVEALLW-NNFPSIKCESSVDANKNNCGNTY 313

  Fly   282 NIELMG----FHVDPKARGRYFLDTNNGPPYAKGE 312
            :...||    |.|   |.|.:::..|...||..||
  Fly   314 SSVFMGASINFFV---AEGIFYVPVNKESPYGLGE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 78/274 (28%)
CG6296NP_651520.1 Pancreat_lipase_like 71..337 CDD:238363 78/274 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445944
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.