DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and CG5665

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001246844.1 Gene:CG5665 / 40243 FlyBaseID:FBgn0036977 Length:395 Species:Drosophila melanogaster


Alignment Length:367 Identity:102/367 - (27%)
Similarity:155/367 - (42%) Gaps:74/367 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NILVLIGFSSVMLVAGLDDMNCFS------LQNEICPNANISFWLYTKENQ-------EGTKLSV 55
            |||..   :.:.|.:.:.|..|.|      :..:|.|:.....:.|....|       |.:||  
  Fly    48 NILTA---APLELASNIIDAVCSSTLFMDRIPAQITPDIRKMHFQYMTPCQNYSVPLLEASKL-- 107

  Fly    56 FELNRFEFYHHKPLKVLI--HGF-NGHRDFSPNTQLRPLFLTQ-DYNLISLDYPKLAYEPCYTEA 116
            ::.:||.    |..||:|  .|: |...:.|..:.:...|:.: |.|.:.:|..... :..|..:
  Fly   108 WKHSRFS----KGRKVVILATGWTNTVNESSAISMISKAFMCRGDVNFVIVDAADYV-DTFYAWS 167

  Fly   117 VHNAKYVARCTAQLLRVLLESGLVKIEDLHLIG-----------------LG--LGAHVAGFIGQ 162
            ..|...:.......|..|:|  |..:.::||||                 :|  ||||:.|..|:
  Fly   168 ALNTDLIGEHIGVGLTHLIE--LTPLRNIHLIGGFIKESFVSINSGSDFFVGHSLGAHIMGTAGR 230

  Fly   163 F---LPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNM 224
            .   |....:..||.||||||.:..:.....|...|||.||::||::.:|.....:|.||||.. 
  Fly   231 TFKKLTGKLIPRITGLDPAKPCFRREKILPGLTRGDAKLVDIIHTNIGILAKRGPLGDVDFYPG- 294

  Fly   225 GVS--QPNCGPINKMETHFCYHNRAADYYAESI--SSPSGFYGFYCPNFKSFAK-----GICIPD 280
            |..  ||.|..|.      |.|.||.:|:|||.  .....|.|..|.::....|     ||..| 
  Fly   295 GAHPIQPGCLTIG------CSHTRAVEYFAESAYPHQEKNFMGKKCASWDELRKRDCSAGIVSP- 352

  Fly   281 KNIELMGFHVDPKARGRYFLDTNNGPPYAKGENFTSISRQLK 322
                 ||:.::|:|||.|::|.|..|||.:....| :..:||
  Fly   353 -----MGYRMNPQARGIYYVDVNGWPPYGRNSENT-VDPRLK 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 86/307 (28%)
CG5665NP_001246844.1 Abhydrolase 85..370 CDD:304388 86/306 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446030
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.