DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and LIPC

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_005254431.2 Gene:LIPC / 3990 HGNCID:6619 Length:511 Species:Homo sapiens


Alignment Length:311 Identity:94/311 - (30%)
Similarity:142/311 - (45%) Gaps:55/311 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FWLYTKENQEGTKLSVFE---LNRFEFYHHKPLKVLIHGF-------NGHRDFSPNTQLRPLFLT 94
            |.|:.:.|| |.::.:..   |....|....||.::|||:       |.........:.:|   .
Human    64 FLLFGETNQ-GCQIRINHPDTLQECGFNSSLPLVMIIHGWSVDGVLENWIWQMVAALKSQP---A 124

  Fly    95 QDYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGF 159
            |..|:..:|:..||::. ||.||.|.:.|.:..|.|||.|.||..:....:||||..|||||:||
Human   125 QPVNVGLVDWITLAHDH-YTIAVRNTRLVGKEVAALLRWLEESVQLSRSHVHLIGYSLGAHVSGF 188

  Fly   160 IGQFL-PEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDV-----TMLGLLDAVGHV 218
            .|..: ..||:..||.||.|.|.:....|:.:|.|.||.|||.:||..     ..:|:...:||.
Human   189 AGSSIGGTHKIGRITGLDAAGPLFEGSAPSNRLSPDDANFVDAIHTFTREHMGLSVGIKQPIGHY 253

  Fly   219 DFYLNMGVSQPNCGPINKMETHF--------------------CYHNRAADYYAES-ISSPSGFY 262
            |||.|.|..||.|        ||                    |.|.|:...:.:| :.:.:...
Human   254 DFYPNGGSFQPGC--------HFLELYRHIAQHGFNAITQTIKCSHERSVHLFIDSLLHAGTQSM 310

  Fly   263 GFYCPNFKSFAKGICIPDK--NIELMGFHV--DPKARG-RYFLDTNNGPPY 308
            .:.|.:..||::|:|:..|  ....:|:||  :|:::. |.||.|....|:
Human   311 AYPCGDMNSFSQGLCLSCKKGRCNTLGYHVRQEPRSKSKRLFLVTRAQSPF 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 92/304 (30%)
LIPCXP_005254431.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.