DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and lipg

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_956422.1 Gene:lipg / 393096 ZFINID:ZDB-GENE-040426-699 Length:500 Species:Danio rerio


Alignment Length:248 Identity:82/248 - (33%)
Similarity:124/248 - (50%) Gaps:27/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 NLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQ 162
            |::.:|:..||.: .|.:||::.:.|.:..|.||..|.|...:::|::|:||..|||||||:.|.
Zfish   121 NVVVVDWLGLANQ-LYPDAVNHTRRVGQSIATLLDWLQEEEQLQLENVHIIGYSLGAHVAGYAGT 184

  Fly   163 FLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDV-----TMLGLLDAVGHVDFYL 222
            |: ...:..||.||||.|.:...|...||.|.||.||||:||..     ..:|:.:.:||:|.|.
Zfish   185 FV-NGIIGRITGLDPAGPMFEGADSYNKLSPDDADFVDVLHTYTRGALGVSIGIQEPIGHIDIYP 248

  Fly   223 NMGVSQPNC--GPI------NKMETHFCYHNRAADYYAESISSPSGF-YGFYCPNFKSFAKGICI 278
            |.|..||.|  |..      |.||...|.|.||...:.:|:.:.... |.|.|.....|.||||:
Zfish   249 NGGDVQPGCTFGEFLSAASGNFMEAMKCEHERAVHLFVDSLMNKDHVSYAFQCTGPDRFKKGICL 313

  Fly   279 P-DKN-IELMGFH---VDPKARGRYFLDTNNGPPYAKGENFTSISRQLKGRTF 326
            . .|| ...:|::   :..:...:.:|.|....|:. |.::     |:|...|
Zfish   314 SCRKNRCNSIGYNAKKMRKRRNSKMYLKTRADTPFG-GYHY-----QMKMHVF 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 76/223 (34%)
lipgNP_956422.1 lipo_lipase 55..488 CDD:132274 82/248 (33%)
Pancreat_lipase_like 65..344 CDD:238363 77/224 (34%)
PLAT_LPL 351..486 CDD:238856 3/15 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.