DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and CG10357

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_647821.2 Gene:CG10357 / 38435 FlyBaseID:FBgn0035453 Length:321 Species:Drosophila melanogaster


Alignment Length:340 Identity:109/340 - (32%)
Similarity:159/340 - (46%) Gaps:72/340 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IGFSSVMLVAGLDDMNCFSLQNEICPNANISFWLYTKENQEGTKLSVFELNRFEFYHHKPLKVLI 73
            :|..:.:|.:.|:....:.|:    |:|::|.     ||.|  :||..|          .:|:::
  Fly    16 LGLHAALLDSLLNQSTIYYLK----PSADVSL-----ENVE--QLSSVE----------SVKLIV 59

  Fly    74 HGFNG---HRDFSPNTQLRPLFLTQDYN---------LISLDYP--KLAYEPCYTEAVHNAKYVA 124
            ||:.|   |....|   ||..:..|.|.         :.:||||  :||           .|.||
  Fly    60 HGYLGSCTHGSIMP---LRNAYTAQGYENVLVADWGPVANLDYPSSRLA-----------VKNVA 110

  Fly   125 RCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPAL 189
            :..|:||...|:...:.:|.:|:||..||||:||.||::. ...|..:|.||||.|.:..:... 
  Fly   111 QILAKLLEEFLQRHGISLEGVHVIGHSLGAHIAGRIGRYF-NGSLGRVTGLDPALPLFSSRSDD- 173

  Fly   190 KLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNMGVS-QPNCGPINKM-------ETHFCYHNR 246
            .|....|:||||:|||..:.|.:...|.||||.|.|:: ||.|..::.:       |.:.|.|||
  Fly   174 SLHSNAAQFVDVIHTDYPLFGDIRPRGTVDFYPNFGLAPQPGCENVDVVAASKLLHEAYSCSHNR 238

  Fly   247 AADYYAESISSPSGFYGFYC--PNFKSFAKGICIPDK---NIE--------LMGFHVDPKARGRY 298
            |..:|||||..|..|....|  ...||.....|:.:|   |.|        .||.||:..|...|
  Fly   239 AVMFYAESIGMPENFPAVSCSLTAIKSRRVEDCLREKSKTNTENANDYQTVFMGEHVNRSATLYY 303

  Fly   299 FLDTNNGPPYAKGEN 313
            :|:||..|||.:|.|
  Fly   304 YLETNGAPPYGQGRN 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 96/300 (32%)
CG10357NP_647821.2 Pancreat_lipase_like 28..308 CDD:238363 99/316 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.