DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and CG6472

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_611166.2 Gene:CG6472 / 36895 FlyBaseID:FBgn0034166 Length:389 Species:Drosophila melanogaster


Alignment Length:299 Identity:112/299 - (37%)
Similarity:153/299 - (51%) Gaps:23/299 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NISFWLYTKENQEGTKL----SVFELNRFEFYHHKPLKVLIHGFN----GHRDFSPNTQLRPLFL 93
            :|.|.|||..|:...:|    ....|.:..|..:.||.:.:|||:    |.|..|  .:|:..||
  Fly    43 DIKFMLYTSRNRNSAQLLHLSDDARLAQSNFNFNYPLAIYLHGFSESATGERQSS--QELKDAFL 105

  Fly    94 TQ-DYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVA 157
            .: :||:|.:|:..:...|.|:.||.|.....|..|:.||.|::.| ...:.:||||..|||.||
  Fly   106 RRGNYNVILIDWSAMTAVPWYSNAVENLPVSGRYLARFLRFLVDKG-YPAKYIHLIGFSLGAEVA 169

  Fly   158 GFIGQFLPEH--KLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDF 220
            ||.|:.|.|.  ||..|||||||.|.:.......:|.|:||:||||:|||..:||....:||.||
  Fly   170 GFAGKQLQEWGIKLPRITALDPALPLFEGNSSNRRLSPSDARFVDVIHTDGGLLGNPAPMGHADF 234

  Fly   221 YLNMG-VSQPNCGPINKMETHF-----CYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGIC-I 278
            |.|.| ..||.|...|......     |.|.||.:|:.|||:.|.||....|.....|  ||| .
  Fly   235 YPNGGRPLQPGCAKQNIANNWLGIIVGCSHQRAWEYFVESIAQPRGFPAQRCEPSDMF--GICRE 297

  Fly   279 PDKNIELMGFHVDPKARGRYFLDTNNGPPYAKGENFTSI 317
            |......||...||:.||:::||||:..|:.:.....:|
  Fly   298 PGGGPAFMGMGADPRIRGKFYLDTNDAKPFGRNSRARAI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 108/283 (38%)
CG6472NP_611166.2 Pancreat_lipase_like 43..323 CDD:238363 109/284 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446000
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.