DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and CG17292

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001285749.1 Gene:CG17292 / 34152 FlyBaseID:FBgn0032029 Length:340 Species:Drosophila melanogaster


Alignment Length:293 Identity:89/293 - (30%)
Similarity:139/293 - (47%) Gaps:27/293 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VFELNRFEFY---HH----KPLKVLIHGFNGHRDFSPNTQLRPLFL-TQDYNLISLDYPKLAYEP 111
            :::|..|:..   .|    |...:.:||:....|......:...:| .:|.|||.||:.:||...
  Fly    40 IYDLTDFQSLLEDEHLDLGKNTVLYLHGYLEDPDVESIHVIAEAYLERKDTNLIVLDWGELADGN 104

  Fly   112 CYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPE-----HKLEH 171
            ...:|..|.|.:....|::|..:.:.|| .||..|::|..:|..:||.:|:.:.:     .|::.
  Fly   105 YMFDAFPNLKQLGPELAKVLLKMFDHGL-DIEKFHIVGHSMGGQLAGLLGREITKRTKGVRKIKR 168

  Fly   172 ITALDPAKP-FYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNMGVS-QPNCGPI 234
            |:|||||.| ||    |...|...||:||||:|||..:.|...:.|..||:.|.|.| ||.|...
  Fly   169 ISALDPAFPLFY----PGTHLSANDAEFVDVIHTDAWLYGAPTSTGTADFWPNGGYSLQPGCPKR 229

  Fly   235 N-KM--ETHFCYHNRAADYYAESISS--PSGFYGFYCPNFKSFAKGICIPDKNIELMGFHVDPKA 294
            | ||  :.....|.|:..::|||:|.  |.||.......:..|.:...:.:....:||.|.....
  Fly   230 NYKMLSDNDLSSHRRSWWFWAESVSDRYPIGFDAVPAKKWSDFKQNKIVENCPPVVMGHHCPTTI 294

  Fly   295 RGRYFLDTNNGPPYAKGENFTSI--SRQLKGRT 325
            .|.::|.||...|:|:|:..|..  .:.|.|.|
  Fly   295 HGDFYLQTNGHTPFARGKEGTVYVDPKDLLGNT 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 80/267 (30%)
CG17292NP_001285749.1 Pancreat_lipase_like 23..303 CDD:238363 80/267 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.