DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and CG7367

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster


Alignment Length:295 Identity:99/295 - (33%)
Similarity:143/295 - (48%) Gaps:28/295 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ISFWLYTKENQEGTKLSVFELNRFEF-YHHK---------------PLKVLIHGFNGHRDFSPNT 86
            |.|.||..::.......:.| |.||| ..||               ..|:|:||:......:...
  Fly    95 IKFELYGSDSSSSADFWIDE-NNFEFPQRHKRDTWQEMAEKFNPELDTKILVHGWKSSTMSNSIQ 158

  Fly    87 QLRPLFLTQ-DYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGL 150
            .:|..::.: ..|:.::::...|....|.........|.|..|:|:.:|:|........:||||.
  Fly   159 SIRGAYIERGQVNVFAINWKDQADNIYYLTPARYTVQVGRAVAKLIDLLVEEKDADPNRIHLIGH 223

  Fly   151 GLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKD---PALKLDPTDAKFVDVVHTDVTMLGLL 212
            .||||:.|:.|.: .::::..||.||||:|.:  :|   |...||.|||.||||:|:....||..
  Fly   224 SLGAHIMGYAGSY-TKYRVNRITGLDPARPAF--EDCIGPENHLDDTDANFVDVIHSCAGYLGFR 285

  Fly   213 DAVGHVDFYLN-MGVSQPNCGPINKMETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGI 276
            ..:|.||||.| .|..||.|..::::.|. |.|.|:.:||||||:||.||||..|..........
  Fly   286 KPIGMVDFYPNGGGPPQPGCKELSQIFTG-CSHGRSYEYYAESINSPKGFYGVPCSGLDELKGKN 349

  Fly   277 CIPDKNIELMGFHVDPKARGRYFLDTNNGPPYAKG 311
            |...|  .|||..|..:|||.:|:.|.|.|.||.|
  Fly   350 CTGGK--ILMGDPVPREARGIFFVKTANKPSYALG 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 93/285 (33%)
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 88/264 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438301
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.