DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and CG18641

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster


Alignment Length:289 Identity:117/289 - (40%)
Similarity:160/289 - (55%) Gaps:10/289 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CPNANISFWLYTKENQEGTK-LSVFELNRFEFYH---HKPLKVLIHGFNGHRDFSPNTQLR-PLF 92
            ||:..|.|:|||:..||..: :.|.:.|...:.|   ..|.|::||||.|.|..||:..|| ..|
  Fly    65 CPHPKIQFYLYTRRTQEQPEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSPSPDLREAYF 129

  Fly    93 LTQDYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGL-VKIEDLHLIGLGLGAHV 156
            ...:||:|.:||.....|||.::.....::.:.|.:||::.|..... |:.:|||.||..:|||:
  Fly   130 SVGEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDLHFIGYSVGAHI 194

  Fly   157 AGFIGQFL-PEH-KLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVD 219
            ||.:..:| ||. ||..||||||...||...:.:..||.|||.||||:||...:||...:.||.|
  Fly   195 AGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGILGQWHSSGHAD 259

  Fly   220 FYLNMGVSQPNC-GPINKMETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICIP-DKN 282
            ||:|.|..||.| |.....:|..|.|.:...|:.|||::..|||...|||..|:..|.|.| |..
  Fly   260 FYVNGGTRQPACVGSATLFQTLACDHTKVTPYFIESITTTRGFYAGPCPNLFSYLIGWCEPKDSE 324

  Fly   283 IELMGFHVDPKARGRYFLDTNNGPPYAKG 311
            ..|||.|...||||.|::.||...|:|:|
  Fly   325 YVLMGEHCSHKARGNYYVTTNAKAPFARG 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 110/275 (40%)
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 111/277 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.759104 Normalized mean entropy S7741
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008540
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.