DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and CG6847

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001285397.1 Gene:CG6847 / 32778 FlyBaseID:FBgn0030884 Length:1000 Species:Drosophila melanogaster


Alignment Length:354 Identity:96/354 - (27%)
Similarity:151/354 - (42%) Gaps:72/354 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 GTKLSVFELNRFEFYHHKPLKVLIHGFNGHRDFSPNTQL----RPLFLTQDYNLISLDYPKLAYE 110
            |.|.....::..|.:....::|::|||.   ...|:..:    ..|...:|..:|.:|:...|..
  Fly   173 GQKKPTPSIDDLEGFDELSVRVIVHGFG---SACPHVWIYEMKTALMAVEDCIVICVDWENGATF 234

  Fly   111 PCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEHITAL 175
            |.|..|..|.:.|.:..|.|||.|.:...:.:...|:||..|||||:||.|..||  .|..||.|
  Fly   235 PNYVRAAANTRLVGKQLAMLLRNLQQHKGLDLMRTHVIGFSLGAHVSGFAGAELP--GLSRITGL 297

  Fly   176 DPAKPFYMVKDPALKLDPTDAKFVDVVHTD-----VTMLGLLDAVGHVDFYLNMGVSQPNCGPI- 234
            |||.|.:..:.|.::||.:||:||||:|::     :..||....:||||:|.|.|..|..|..: 
  Fly   298 DPAGPLFEAQHPKVRLDSSDAEFVDVIHSNGENLILGGLGSWQPMGHVDYYPNGGRVQTGCSNLF 362

  Fly   235 ---------------NKMETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICIP----D 280
                           ::.....|.|.||..::.:|::....|..|.|.|:..|.||.|.|    |
  Fly   363 VGAVTDFIWSAQAAEDEEGRSLCNHRRAYKFFIDSVAPRCLFPAFPCGNYDDFLKGRCFPCAQDD 427

  Fly   281 KNIE-------LMGFHVD-PKARGRYFLDTNNGPPYAKGE-------NFTSISRQLKGR------ 324
            :::.       .||::.| ...||:.:|.|....|:...:       :|..:..:..||      
  Fly   428 EDLAEGVPRCGNMGYYADRSTGRGQLYLLTREEEPFCAHQFQLQIFNSFNDLPLRTIGRLEAILE 492

  Fly   325 -----------------TFVNDDIIDKLI 336
                             .|...||:.|:|
  Fly   493 GDGGLNETFEISEKDDAEFFAGDIVSKII 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 86/289 (30%)
CG6847NP_001285397.1 Lipase 70..463 CDD:278576 87/294 (30%)
Pancreat_lipase_like 185..459 CDD:238363 85/278 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438333
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.