DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and Yp3

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001285228.1 Gene:Yp3 / 32339 FlyBaseID:FBgn0004047 Length:420 Species:Drosophila melanogaster


Alignment Length:361 Identity:97/361 - (26%)
Similarity:134/361 - (37%) Gaps:110/361 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LQNEICPN-----ANISFWLYTKENQEGTKLSVFELNRFEFYHHKPLKVLIHGF---------NG 78
            :::::.|:     :|:..|: .|.|  |.|:.....|..|....:|      ||         .|
  Fly    74 IKHDLTPSFVPSPSNVPVWI-IKSN--GQKVECKLNNYVETAKAQP------GFGEDEVTIVLTG 129

  Fly    79 HRDFSPNTQ--LRPLF--LTQDYNLISL--------------DYPKLAYEPCYTEAVHNAKYVAR 125
            ....||..|  :|.|.  ..|.|||..|              ||...:.|    ||....|....
  Fly   130 LPKTSPAQQKAMRRLIQAYVQKYNLQQLQKNAQEQQQQLKSSDYDYTSSE----EAADQWKSAKA 190

  Fly   126 CTAQLLRVLLESGL-----------------------------VKIEDLHLIGLGLGAHVAGFIG 161
            .:..|:.:.|.|.|                             |..|.:||||.|:.|||||..|
  Fly   191 ASGDLIIIDLGSTLTNFKRYAMLDVLNTGAMIGQTLIDLTNKGVPQEIIHLIGQGISAHVAGAAG 255

  Fly   162 -QFLPE--HKLEHITALDPAKPFYMVKDPAL--KLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFY 221
             ::..:  |||..||.|||||  .:.|.|.:  .|...||.|||.:||....:|.....|.||||
  Fly   256 NKYTAQTGHKLRRITGLDPAK--VLSKRPQILGGLSRGDADFVDAIHTSTFAMGTPIRCGDVDFY 318

  Fly   222 LNMGVSQPNCGPINKMETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICIPDKNIE-- 284
            .| |.|....|..|.:|.    ..||..|:|||:...|.      .||.:      :|..:::  
  Fly   319 PN-GPSTGVPGSENVIEA----VARATRYFAESVRPGSE------RNFPA------VPANSLKQY 366

  Fly   285 ----------LMGFHVDPKARGRYFLDTNNGPPYAK 310
                      .||..:|...||.|.|:.|...|:.:
  Fly   367 KEQDGFGKRAYMGLQIDYDLRGDYILEVNAKSPFGQ 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 94/338 (28%)
Yp3NP_001285228.1 Lipase 93..400 CDD:278576 93/338 (28%)
Abhydrolase <215..396 CDD:304388 62/199 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438312
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.