DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and Yp1

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001285071.1 Gene:Yp1 / 31939 FlyBaseID:FBgn0004045 Length:439 Species:Drosophila melanogaster


Alignment Length:280 Identity:76/280 - (27%)
Similarity:110/280 - (39%) Gaps:73/280 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 HGFNGHRDFSPNTQLRPLFLTQDYNLISLDYPKLAYEPCYTEAVHNAK----------------- 121
            ||.||::|:            ||.:.......:.:.|..|:|.|.|||                 
  Fly   163 HGKNGNQDY------------QDQSNEQRKNQRTSSEEDYSEEVKNAKTQSGDIIVIDLGSKLNT 215

  Fly   122 ---YV--------ARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQ---FLPEHKLEHI 172
               |.        |:....:::::.|..: ..:.:||||..:||||||...|   .|..|||..:
  Fly   216 YERYAMLDIEKTGAKIGKWIVQMVNELDM-PFDTIHLIGQNVGAHVAGAAAQEFTRLTGHKLRRV 279

  Fly   173 TALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNMGVSQPNCGPINKM 237
            |.|||:|.....|:....|...||:|||.:||.|..:|.....|.||||.| |.:....|..|.:
  Fly   280 TGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSVYGMGTPIRSGDVDFYPN-GPAAGVPGASNVV 343

  Fly   238 ETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICIPDKNIE------------LMGFHV 290
            |...    ||..|:|||: .|.        |.:||.   .:|..:::            .||...
  Fly   344 EAAM----RATRYFAESV-RPG--------NERSFP---AVPANSLQQYKQNDGFGKRAYMGIDT 392

  Fly   291 DPKARGRYFLDTNNGPPYAK 310
            .....|.|.|..|...|:.:
  Fly   393 AHDLEGDYILQVNPKSPFGR 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 74/271 (27%)
Yp1NP_001285071.1 Abhydrolase 183..406 CDD:304388 67/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.