DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and CG1986

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001285067.1 Gene:CG1986 / 31925 FlyBaseID:FBgn0030162 Length:404 Species:Drosophila melanogaster


Alignment Length:266 Identity:80/266 - (30%)
Similarity:121/266 - (45%) Gaps:35/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 HKPLKVLIHGFN--GHRDFSPNTQLRPLFLTQDYNLISLDYPKLAYEPCYTEAVHNAKYVARCTA 128
            :|.|.:.:||:|  |.:|:.....|.......:||:..:|:..|:... |..|..:...|....|
  Fly    92 NKKLALFLHGWNDQGSKDWVQELLLTWTLFDSNYNVCVVDWGNLSQND-YKSASMSIFDVGLTVA 155

  Fly   129 QLLRVLLESGLVKIEDLH-----LIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVK--- 185
            .::..|.|   ::....|     |.|..||||.||:.|..| |.::|.|..||||.|.:.:.   
  Fly   156 GIIMALEE---LRPNHFHRSNVTLAGYSLGAHAAGYAGAVL-EGQVEQIIGLDPAGPLFSLPAEV 216

  Fly   186 DPALKLDPTDAKFVDVVHTDVTMLGLLDAVGHVDFYLNMG-VSQPNC------------GPINKM 237
            .|..:|||.||:||.|:||....||.....||.|||.|.| ..|.||            .|::  
  Fly   217 APKYRLDPGDAQFVQVLHTSGGSLGTSLKCGHADFYPNGGRAPQTNCKMFANLRDMQNTNPVS-- 279

  Fly   238 ETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGICIPDKNIELMGFHVDPKARGRYFLDT 302
                |.|:.||.::.:|:.....|.|:.|.:::.||.|.|..::... .|.|...:|:|.::..|
  Fly   280 ----CSHSAAAIFFRQSMDPEYPFVGYECGSYREFAAGYCDGNRKAR-FGIHSQRRAQGSFYFRT 339

  Fly   303 NNGPPY 308
            ....||
  Fly   340 APQQPY 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 77/259 (30%)
CG1986NP_001285067.1 Pancreat_lipase_like 67..341 CDD:238363 78/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.