DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and lpl

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_571202.1 Gene:lpl / 30354 ZFINID:ZDB-GENE-990415-139 Length:511 Species:Danio rerio


Alignment Length:268 Identity:84/268 - (31%)
Similarity:120/268 - (44%) Gaps:36/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VLIHGFNGHRDFSPNTQLRPLFLTQDY------NLISLDYPKLAYEPCYTEAVHNAKYVARCTAQ 129
            ::|||:.....|.   ...|..:|..|      |:|.:|:...|.:...|.|.: .|.|.:..|:
Zfish    96 IVIHGWTVTGMFE---SWVPKLVTALYEREPSANVIVVDWLSRAQQHYPTSASY-TKLVGKDVAK 156

  Fly   130 LLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPT 194
            .:..|........|.|||:|..|||||||..| .|.:||:..||.:|||.|.:...|....|.|.
Zfish   157 FVNWLQAEIDYPWEKLHLLGYSLGAHVAGIAG-LLTKHKVNRITGMDPAGPTFEYADSLSTLSPD 220

  Fly   195 DAKFVDVVHTDV-----TMLGLLDAVGHVDFYLNMGVSQPNCGPINKM------------ETHFC 242
            ||.||||:||:.     ..:|:...|||:|.|.|.|..||.|...|.|            :...|
Zfish   221 DANFVDVLHTNTRGSPDRSIGIQRPVGHIDIYPNGGTFQPGCDLQNTMLMVATTGLRNMDQIVKC 285

  Fly   243 YHNRAADYYAES-ISSPSGFYGFYCPNFKSFAKGICIP-DKN-IELMGFHVDPKARGR----YFL 300
            .|.|:...:.:| ::.......|.|.:..||.||:|:. .|| ...:|:.|: |.|.|    .::
Zfish   286 SHERSIHLFIDSLVNQDHESMAFRCSSRDSFNKGMCLSCRKNRCNKVGYAVN-KIRTRRSSKMYM 349

  Fly   301 DTNNGPPY 308
            .|....||
Zfish   350 KTREMMPY 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 81/261 (31%)
lplNP_571202.1 lipo_lipase 52..492 CDD:132274 84/268 (31%)
Pancreat_lipase_like 56..353 CDD:238363 82/262 (31%)
PLAT 360..484 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.