DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and Lpl

DIOPT Version :10

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_036730.1 Gene:Lpl / 24539 RGDID:3017 Length:474 Species:Rattus norvegicus


Alignment Length:276 Identity:80/276 - (28%)
Similarity:124/276 - (44%) Gaps:36/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 FYHHKPLKVLIHGF---NGHRDFSPNTQLRPLFLTQDYNLISLDYPKLAYEPCYTEAVHNAKYVA 124
            |.|.....|:|||:   ..:..:.|...........|.|:|.:|:...|.:. |..:....|.|.
  Rat    69 FNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLYRAQQH-YPVSAGYTKLVG 132

  Fly   125 RCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPAL 189
            ...|:.:..|.|.....::::||:|..||||.||..|. |...|:..||.||||.|.:...:...
  Rat   133 NDVARFINWLEEEFNYPLDNVHLLGYSLGAHAAGVAGS-LTNKKVNRITGLDPAGPNFEYAEAPS 196

  Fly   190 KLDPTDAKFVDVVHTDV-----TMLGLLDAVGHVDFYLNMGVSQPNC--------------GPIN 235
            :|.|.||.||||:||..     ..:|:...|||||.|.|.|..||.|              |.::
  Rat   197 RLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIRVIAEKGLGDVD 261

  Fly   236 KMETHFCYHNRAADYYAESI---SSPSGFYGFYCPNFKSFAKGICIP-DKN-IELMGFHVD---P 292
            ::..  |.|.|:...:.:|:   .:||..|  .|.:.::|.||:|:. .|| ...:|:.::   .
  Rat   262 QLVK--CSHERSIHLFIDSLLNEENPSKAY--RCNSKEAFEKGLCLSCRKNRCNNVGYEINKVRA 322

  Fly   293 KARGRYFLDTNNGPPY 308
            |...:.:|.|.:..||
  Rat   323 KRSSKMYLKTRSQMPY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 77/269 (29%)
LplNP_036730.1 Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 32..53
lipo_lipase 33..472 CDD:132274 80/276 (29%)
Essential for determining substrate specificity. /evidence=ECO:0000250|UniProtKB:P06858 243..266 2/24 (8%)
Important for interaction with lipoprotein particles. /evidence=ECO:0000250|UniProtKB:P06858 417..421
Important for heparin binding. /evidence=ECO:0000250|UniProtKB:P06858 430..434
Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 443..467
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.