DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and LIPH

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_640341.1 Gene:LIPH / 200879 HGNCID:18483 Length:451 Species:Homo sapiens


Alignment Length:331 Identity:91/331 - (27%)
Similarity:152/331 - (45%) Gaps:45/331 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CFSLQN--EICPN--------------ANISFWLYTKEN---QEGTKLSVF-ELNRFEFYHHKPL 69
            |.|..:  |.||:              .|:...|||::|   .:....|.| .||     ..|..
Human    12 CLSRSDAEETCPSFTRLSFHSAVVGTGLNVRLMLYTRKNLTCAQTINSSAFGNLN-----VTKKT 71

  Fly    70 KVLIHGF--NGHRDFSPNTQLRPLFLTQDYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLR 132
            ..::|||  .|......:..::.|...:|.|::.:|:.:.|....||.|....:.||....:.:.
Human    72 TFIVHGFRPTGSPPVWMDDLVKGLLSVEDMNVVVVDWNRGATTLIYTHASSKTRKVAMVLKEFID 136

  Fly   133 VLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAK 197
            .:|..| ..::|:::||:.||||::||:|: :.:..|..||.||||.|.:..|....:|||:||:
Human   137 QMLAEG-ASLDDIYMIGVSLGAHISGFVGE-MYDGWLGRITGLDPAGPLFNGKPHQDRLDPSDAQ 199

  Fly   198 FVDVVHTDVTMLGLLDAVGHVDFYLNMGVSQPNCGP--INKMETHFCYHNRAADYYAESISSPSG 260
            ||||:|:|...||..:.:|::|||.|.|:.||.|..  :...:...|.|.|:...|..|:.....
Human   200 FVDVIHSDTDALGYKEPLGNIDFYPNGGLDQPGCPKTILGGFQYFKCDHQRSVYLYLSSLRESCT 264

  Fly   261 FYGFYCPNFKSFAKGICI-----PDKNIELMGFHVD---PKARG------RYFLDTNNGPPYAKG 311
            ...:.|.:::.:..|.|:     ..::..|:|::.|   ...||      :.|.||....|:...
Human   265 ITAYPCDSYQDYRNGKCVSCGTSQKESCPLLGYYADNWKDHLRGKDPPMTKAFFDTAEESPFCMY 329

  Fly   312 ENFTSI 317
            ..|..|
Human   330 HYFVDI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 82/287 (29%)
LIPHNP_640341.1 Pancreat_lipase_like 39..303 CDD:238363 78/270 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.