DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and PNLIPRP3

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_001011709.2 Gene:PNLIPRP3 / 119548 HGNCID:23492 Length:467 Species:Homo sapiens


Alignment Length:332 Identity:106/332 - (31%)
Similarity:153/332 - (46%) Gaps:50/332 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NISFWLYTKEN----QEGTKLSVFELNRFEFYHHKPLKVLIHGF----NGHRDFSPNTQLRPLFL 93
            |..|.|||..|    ||.:.::...:....|...|..::.|.|:    ...||     ....|..
Human    53 NTRFLLYTIHNPNAYQEISAVNSSTIQASYFGTDKITRINIAGWKTDGKWQRD-----MCNVLLQ 112

  Fly    94 TQDYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAG 158
            .:|.|.|:||:...:.|  |..||:|.:.|....|..:.||::........:||||..||||:||
Human   113 LEDINCINLDWINGSRE--YIHAVNNLRVVGAEVAYFIDVLMKKFEYSPSKVHLIGHSLGAHLAG 175

  Fly   159 FIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTML------GLLDAVGH 217
            ..|..:|  .|..||.||||.||:......::|||:||.||||:||:...:      |.:||.||
Human   176 EAGSRIP--GLGRITGLDPAGPFFHNTPKEVRLDPSDANFVDVIHTNAARILFELGVGTIDACGH 238

  Fly   218 VDFYLNMGVSQPNCGPI-------------NKMETHF-CYHNRAADYYAESISSPSGFYGFYCPN 268
            :|||.|.|...|.|..:             .:|.:.| |.|.|:..:|||||.:|..|..:.|.:
Human   239 LDFYPNGGKHMPGCEDLITPLLKFNFNAYKKEMASFFDCNHARSYQFYAESILNPDAFIAYPCRS 303

  Fly   269 FKSFAKGICI--PDKNIELMG-----FHV-DPKARG-RYFLDTNNGPPYAKGENFTSI----SRQ 320
            :.||..|.|.  ..:....||     ||. :.|..| .|||:|.:..|:|:..:..|:    |..
Human   304 YTSFKAGNCFFCSKEGCPTMGHFADRFHFKNMKTNGSHYFLNTGSLSPFARWRHKLSVKLSGSEV 368

  Fly   321 LKGRTFV 327
            .:|..|:
Human   369 TQGTVFL 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 99/302 (33%)
PNLIPRP3NP_001011709.2 Lipase 18..352 CDD:278576 100/307 (33%)
Pancreat_lipase_like 52..348 CDD:238363 100/303 (33%)
PLAT_PL 355..467 CDD:238857 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145197
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.