DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and LOC101884800

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_005174466.1 Gene:LOC101884800 / 101884800 -ID:- Length:530 Species:Danio rerio


Alignment Length:389 Identity:101/389 - (25%)
Similarity:161/389 - (41%) Gaps:96/389 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LVLIGFSSVMLVAGLDDMNC------------------FSLQNEICPNANISFWLYTKENQEGTK 52
            |:|:|||   |:|.....|.                  ||:::...|:.::.:.:      .|.:
Zfish     8 LLLMGFS---LIASEPIFNSTEEAFASNFTDYSDIESKFSIRSVEFPDEDLCYLV------PGQQ 63

  Fly    53 LSVFELNRFEFYHHKPLKVLIHGFNGHRDFSPNTQLRPLFLTQDYNLISLDYPKLAYEPC----- 112
            .|:.:.|   |.:.....::|||::          :..||.:..|.|::..|.:   ||.     
Zfish    64 DSISDCN---FKNDSQTFLIIHGWS----------VAGLFESWVYKLVTALYDR---EPSANVIV 112

  Fly   113 ----------YTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEH 167
                      |.::..|.:.|....|:.:..|.|.. ..:|.:||:|..|||||||..|. |..:
Zfish   113 VDWLDRANKHYPKSAENTRLVGADVAKFVNWLEELD-YPLEKVHLLGYSLGAHVAGVAGN-LTNN 175

  Fly   168 KLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDV-----TMLGLLDAVGHVDFYLNMGVS 227
            |:..||.||||.|.:...|...:|.|.||.||||:||:.     ..:|:...|||||.|.|.|..
Zfish   176 KVHRITGLDPAGPSFENADILRRLSPDDASFVDVLHTNTRGSPDLSIGIQRPVGHVDIYPNGGTF 240

  Fly   228 QP------------NCGPINKMETHFCYHNRAADYYAES-ISSPSGFYGFYCPNFKSFAKGICIP 279
            ||            .||..|..:...|.|.|:...:.:| ::.....:.|.|.:..||.||:|:.
Zfish   241 QPGCSIQHTMKLIATCGIYNMDQIVKCSHERSIHLFIDSLVNQAYQSWAFRCASRDSFNKGLCLS 305

  Fly   280 -DKN-IELMGFHVDPKARG----RYFLDTNNGPPYA-----------KGENFTSISRQLKGRTF 326
             .|| ...:|::| .|.|.    :.:|.|....|:.           ..:|.|.:.:.:|...|
Zfish   306 CRKNRCNTLGYNV-KKIRSTRSTKMYLKTREMMPFKVFHYQIKMHMFSDKNMTLLEQPMKVSLF 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 84/304 (28%)
LOC101884800XP_005174466.1 lipo_lipase 35..473 CDD:132274 93/359 (26%)
Pancreat_lipase_like 39..335 CDD:238363 88/320 (28%)
PLAT 342..464 CDD:294016 4/27 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.