DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and LOC100487482

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_017945498.2 Gene:LOC100487482 / 100487482 -ID:- Length:347 Species:Xenopus tropicalis


Alignment Length:315 Identity:86/315 - (27%)
Similarity:142/315 - (45%) Gaps:51/315 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DDMNCF--------SLQNEIC------PNANISFWLYTKENQEG----TKLSVFELNRFEFYHHK 67
            |.:.||        ::|..|.      ...|:.|.|||:.||..    :.::...::...|...:
 Frog    23 DRIGCFADTSPYAGTVQRPITKLPWAPEKINVQFMLYTRSNQNSYQTVSAITPSTISSSNFRTSR 87

  Fly    68 PLKVLIHGF--NGHRDFSPNTQLRPLFLTQDYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQL 130
            ..:.:||||  :|...:..| ..:.|...:|.|.|::|:.. .....|::|.:|.:.|....|..
 Frog    88 KTRFVIHGFISSGTNSWVTN-MCKKLLGIEDVNCIAVDWSG-GSRTLYSQASNNVRVVGAEVAYF 150

  Fly   131 LRVLLESGLVKIEDLHLIGLGLGAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTD 195
            :::|..:......::||||..||||.||..|:  .:..:..|:.||||:|::......::||.:|
 Frog   151 VKILQSNFAYSPANVHLIGHSLGAHAAGEAGK--RQKGIARISGLDPAEPYFQNTPAEVRLDTSD 213

  Fly   196 AKFVDVVHTDVTML------GLLDAVGHVDFYLNMGVSQPNC----------------GPINKME 238
            |..|||:|||...|      |:...:||:||:.|.||..|.|                |.:|.:.
 Frog   214 AALVDVIHTDAGPLVPSLGFGMSQVIGHLDFFPNGGVHMPGCPQNIEIPNVNVEDIWNGVVNFVT 278

  Fly   239 THFCYHNRAADYYAESISSPSGFYGFYCPNFKSFAKGIC--IPDKNIELMGFHVD 291
               |.|.:|..||.:||.:...|..:.|.|:.::.:|.|  .|......||.:.|
 Frog   279 ---CNHEKAVSYYTDSIGNSGTFASYPCANWDTYQRGSCKSCPSAGCPKMGHYAD 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 81/285 (28%)
LOC100487482XP_017945498.2 Lipase 19..346 CDD:395099 86/315 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.