DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14034 and LOC100331214

DIOPT Version :9

Sequence 1:NP_001036339.1 Gene:CG14034 / 33751 FlyBaseID:FBgn0250847 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:309 Identity:92/309 - (29%)
Similarity:139/309 - (44%) Gaps:37/309 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FSLQNEICPNANISFWLYTKENQEGTKLSVFELNRFEFYHHKPLKVLIHGFNGHRDFSPNTQLRP 90
            |||:|...|:.::.:.:..|..         .|:...|.|.....::|||:.....|....:...
Zfish    55 FSLRNPSQPDDDVCYIVRGKAE---------TLSSCNFNHTSKTILVIHGWTVSGLFESWVEKLV 110

  Fly    91 LFL---TQDYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGL 152
            ..|   .:|.|:|.:|:...|.:. |..|..|.|.|.|.....:..:.|:..|.:|:|||||..|
Zfish   111 AALYNREKDANVIVVDWLDTAQDH-YVVAAQNTKMVGREIGLFIDWIEETSNVPLENLHLIGYSL 174

  Fly   153 GAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDV-----TMLGLL 212
            |||||||.|.. ..:|:..||.||||.|.:.......:|.|.||.||||:||..     ..:|:.
Zfish   175 GAHVAGFAGSH-TTNKIGRITGLDPAGPDFEGVHAHGRLSPDDAHFVDVLHTFTRGSLGLSIGIE 238

  Fly   213 DAVGHVDFYLNMGVSQPNC---GPINKMETH---------FCYHNRAADYYAES-ISSPSGFYGF 264
            ..|||||.|.|.|..||.|   |.:.||.::         .|.|.|:...:.:| ::..:....:
Zfish   239 QPVGHVDIYPNGGSFQPGCNLRGALEKMASYGIFAINNAIRCEHERSIHLFIDSLLNEEAAGRAY 303

  Fly   265 YCPNFKSFAKGICIP-DKN-IELMGFHVDP--KARG-RYFLDTNNGPPY 308
            .|.:...|.:|:|:. .|| ...:|:.:..  |||. :.|..|....|:
Zfish   304 SCGSNDMFDRGVCLQCRKNGCNTVGYDISKVRKARSVKMFTKTRGSMPF 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14034NP_001036339.1 Pancreat_lipase_like 37..303 CDD:238363 85/291 (29%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 92/309 (30%)
Pancreat_lipase_like 51..347 CDD:238363 90/302 (30%)
PLAT_LPL 355..485 CDD:238856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.