DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IAPP and iapp

DIOPT Version :10

Sequence 1:NP_000406.1 Gene:IAPP / 3375 HGNCID:5329 Length:89 Species:Homo sapiens
Sequence 2:XP_002661886.3 Gene:iapp / 100334757 -ID:- Length:124 Species:Danio rerio


Alignment Length:53 Identity:35/53 - (66%)
Similarity:43/53 - (81%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    25 IESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVE 77
            :.||.|||||||||||.|||||:||:.|||..|.:.:.|||||||||||:.::
Zfish    67 LNSHHVEKRKCNTATCVTQRLADFLIRSSNTIGTVYAPTNVGSNTYGKRDLLQ 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IAPPNP_000406.1 Calc_CGRP_IAPP <27..73 CDD:459715 33/45 (73%)
iappXP_002661886.3 Calc_CGRP_IAPP 1..116 CDD:459715 34/48 (71%)

Return to query results.
Submit another query.