DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28d1 and CYP721A1

DIOPT Version :9

Sequence 1:NP_608912.1 Gene:Cyp28d1 / 33749 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_177649.1 Gene:CYP721A1 / 843850 AraportID:AT1G75130 Length:505 Species:Arabidopsis thaliana


Alignment Length:541 Identity:118/541 - (21%)
Similarity:201/541 - (37%) Gaps:149/541 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ILALIYVFLTWNF------------SYWKKRGI--PT-----------------AKSWPFVGSFP 47
            ||.|::.||.:.|            |::||:.:  |:                 |||.|    .|
plant     6 ILVLVFFFLVFRFIYSNIWVPWRIQSHFKKQSVTGPSYRIFSGNSGEVSRLTAEAKSKP----IP 66

  Fly    48 SVFTQKRNVVYDIDEIYEQYKNTDSIVG-----------VFQTRIPQLM---VTT----PEYAHK 94
            |    .||....:..:...|.....:.|           |..|..|:|:   :||    ....|.
plant    67 S----GRNPHEFVHRVAPHYHEWSRVYGKTFLYWFGSKPVVATSDPRLIREALTTGGSFDRIGHN 127

  Fly    95 -----IYV-------SDFRSFHDNEMAK--FTDSKTD---PILANNPFVLTGEAWKERRAEVTPG 142
                 :|.       .|..:|| ..:||  ||..|..   |.:..:..:|. |.|::.|      
plant   128 PLSKLLYAQGLPGLRGDQWAFH-RRIAKQAFTMEKLKRWVPQMVTSTMMLM-EKWEDMR------ 184

  Fly   143 LSANRVKAAYPVSLRVCKKFVEYIRRQSLMAPAQGLNAKDLCLCYTTEVISDCVLGISAQSFTDN 207
                  .....:.|.|.|:.             ..|:|         |::|....|.|.:.    
plant   185 ------NGGEEIELEVHKEM-------------HNLSA---------EMLSRTAFGNSVEE---- 217

  Fly   208 PTPMVGMTKRVFE--QSFGFIFYTVVANLWPPITKFY------SVSLFAKDVAAFFYDLMQKCIQ 264
                   .|.:||  :....:||.|..:::.|..:|:      .:....|.:......|::....
plant   218 -------GKGIFELQERMMRLFYLVRWSVYIPGFRFFPSKTNREIWRIEKQIRVSILKLIENNKT 275

  Fly   265 VRRESPAAQQRDDFLN-YMLQLQEKKGLNAAELTSHTMTFLTDGFETTAQVLTHTLLFLARNPKE 328
            ...:|....|.  |:: |..|..:::.|...|:|....||.....||||.::|..|:.||.|.:.
plant   276 AVEKSGTLLQA--FMSPYTNQNGQEEKLGIEEVTDECKTFYFAAKETTANLMTFVLVLLAMNQEW 338

  Fly   329 QMKLREEI----GTAEL-TFEQISELPFTEACIHETLRIFSPVLAARKVVTEPCELTNKNGVSVK 388
            |...|||:    |...| |.:.:.:|......|:||||::.|.:...:...:..:|.:     :.
plant   339 QNIAREEVICVLGQTGLPTLDILQDLKTLSMIINETLRLYPPAMTLNRDTLKRAKLGD-----LD 398

  Fly   389 LRPGDVVIIPVNALHHDPQYY-EEPQSFKPERFLNINGGAKKYRDQGLFFGFGDGPRICPGMRFS 452
            :..|..:.:.|.|:|||.:.: ::.:.|.|.||.:    .||  ...|...||.|||.|.|...:
plant   399 IPAGTQLYLSVVAMHHDKETWGDDAEEFNPRRFED----PKK--QSALLVPFGLGPRTCVGQNLA 457

  Fly   453 LTQIKAALVEIVRNFDIKVNP 473
            :.:.|..|..|::.:..:::|
plant   458 VNEAKTVLATILKYYSFRLSP 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 109/506 (22%)
CYP721A1NP_177649.1 p450 26..495 CDD:386267 112/521 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3438
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.