DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28d1 and Cyp3a73

DIOPT Version :9

Sequence 1:NP_608912.1 Gene:Cyp28d1 / 33749 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster
Sequence 2:XP_038945885.1 Gene:Cyp3a73 / 498198 RGDID:1595705 Length:504 Species:Rattus norvegicus


Alignment Length:489 Identity:144/489 - (29%)
Similarity:240/489 - (49%) Gaps:51/489 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VIAAILALIYVFLTWNFSYWKKRGIPTAKSWPFVGSFPSVFTQKRNV-VYDIDEIYEQYKNTDSI 73
            ::|.||.|.|.|.|.....:||:|||..|..||:|   :|....|.: .:|:    |.||....|
  Rat    14 LLAIILVLFYRFGTRTHGIFKKQGIPGPKPLPFLG---TVLNYYRGLWKFDM----ECYKKCGKI 71

  Fly    74 VGVFQTRIPQLMVTTPEYAHKIYVSDFRSFHDNEMAKFTDSKT-DP--ILANNPFVLTGEAWKER 135
            .|:|..:.|...:...|....:.|.:..|.       ||:.:. .|  |::.:..|...|.||..
  Rat    72 WGLFDGQTPVFAIMDTEMIKSVLVKECFSV-------FTNRRNIGPVGIMSKSISVAKDEEWKRY 129

  Fly   136 RAEVTPGLSANRVKAAYPVSLRVCKKFVEYIRRQSLMAPAQGLNAKDLCLCYTTEVISDCVLGIS 200
            ||.::|..::.|:|..:|:........|:|::::  :...:.|..|::...|:.:||:.....::
  Rat   130 RAFLSPTFTSGRLKEMFPIIEHYGDILVKYLKQK--VEKGKPLAMKEVFGAYSMDVITSTSFEVN 192

  Fly   201 AQSFTDNPTPMVGMTKRVFEQSFGF---IFYTVVANLWP---PITKFYSVSLFAKDVAAFFYDLM 259
            ..|..:...|.|...|:.  |.|.|   :|.:||  |:|   ||.:..::.||.||..|||...:
  Rat   193 INSINNPKDPFVEKVKKF--QRFDFFDPLFLSVV--LFPFLTPIYEMLNICLFPKDSVAFFQKFV 253

  Fly   260 QKCIQVRRESPAAQQRDDFLNYMLQLQEK-------KGLNAAELTSHTMTFLTDGFETTAQVLTH 317
            .:..|.|.:| ..:.|.|||..|:.....       |.|:..|:.:..:.|:...:|||:..|:.
  Rat   254 YRMKQTRLDS-KHKHRVDFLQLMMNAHNNSKDKVSHKALSDIEIVAQAIIFIFASYETTSSTLSF 317

  Fly   318 TLLFLARNPKEQMKLREEI-----GTAELTFEQISELPFTEACIHETLRIFSPVLAARKVVTEPC 377
            .|..||.:|..|.||:|||     ..|..|::.:.|:.:.:..::||.|::.......:|..:..
  Rat   318 VLYSLATHPDSQKKLQEEIDRALPNKAPPTYDTVMEMEYLDMVLNETPRLYPIGYRLERVCKKDI 382

  Fly   378 ELTNKNGVSVKLRPGDVVIIPVNALHHDPQYYEEPQSFKPERFLNINGGAKKYRDQGLFFGFGDG 442
            :|   :||.:.  .|.||:||...|.||||::.||:.|.||||...|.|:   .|..::..||:|
  Rat   383 KL---DGVFIP--KGSVVMIPFYTLQHDPQHWPEPEEFLPERFSKENKGS---IDPYVYLPFGNG 439

  Fly   443 PRICPGMRFSLTQIKAALVEIVRNFDIKVNPKTR 476
            ||.|.||||:|..:|.||.::::||..::..:|:
  Rat   440 PRNCIGMRFALMNMKLALTKVLQNFSFQLCEETQ 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 133/464 (29%)
Cyp3a73XP_038945885.1 CYP3A 67..493 CDD:410743 122/429 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D264519at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.