DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp28d1 and Cyp12a4

DIOPT Version :9

Sequence 1:NP_608912.1 Gene:Cyp28d1 / 33749 FlyBaseID:FBgn0031689 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_650783.2 Gene:Cyp12a4 / 42294 FlyBaseID:FBgn0038681 Length:536 Species:Drosophila melanogaster


Alignment Length:392 Identity:99/392 - (25%)
Similarity:166/392 - (42%) Gaps:76/392 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 GEAWKERRAEVTPGL-SANRVKAAYPVSLRVCKKFVEYIRR----QSLMAPAQGLNAKDLCLCYT 188
            |:.|.:.|..|.|.| ....|:..|....:|.::||:.|..    .:|.||...:   |....:|
  Fly   151 GKPWGDFRTVVNPVLMQPKNVRLYYKKMSQVNQEFVQRILELRDPDTLEAPDDFI---DTINRWT 212

  Fly   189 TEVISDCVLGISAQSFTDNPTPMVGMTKRVFEQS-----FGFI--FYTVVANL------W----- 235
            .|.:|  |:.:..|         :|:.|...::|     |.::  |:.|..:|      |     
  Fly   213 LESVS--VVALDKQ---------LGLLKNSNKESEALKLFHYLDEFFIVSIDLEMKPSPWRYIKT 266

  Fly   236 PPITK-------FYSVSLFAKDVAAFFYDLMQKCIQVRRESPAAQQRDDFLNYMLQLQEKKGLNA 293
            |.:.:       ...|:|...|.|....|...|...||.|:     ....|..:|::..|..   
  Fly   267 PKLKRLMRALDGIQEVTLAYVDEAIERLDKEAKEGVVRPEN-----EQSVLEKLLKVDRKVA--- 323

  Fly   294 AELTSHTMTFLTDGFETTAQVLTHTLLFLARNPKEQMKLREEI------GTAELTFEQISELPFT 352
               |...|..|..|.:||:...|..||.||:||::|.:||||:      ..:|.|...:..:|:.
  Fly   324 ---TVMAMDMLMAGVDTTSSTFTALLLCLAKNPEKQARLREEVMKVLPNKNSEFTEASMKNVPYL 385

  Fly   353 EACIHETLRIFSPVLAARKVVTEPCELTNKNGVSVKLRPGDVV-IIPVNALHHDPQYYEEPQSFK 416
            .|||.|:.|:...::...:|:.....|:     ..::..|..| |:|:|||..| :|:.:...|.
  Fly   386 RACIKESQRLHPLIVGNARVLARDAVLS-----GYRVPAGTYVNIVPLNALTRD-EYFPQASEFL 444

  Fly   417 PERFLNINGGAK--------KYRDQGLFFGFGDGPRICPGMRFSLTQIKAALVEIVRNFDIKVNP 473
            |||:|.....::        |..:..:|..||.|||:|.|.|....:::.....::|||:::.|.
  Fly   445 PERWLRSPKDSESKCPANELKSTNPFVFLPFGFGPRMCVGKRIVEMELELGTARLIRNFNVEFNY 509

  Fly   474 KT 475
            .|
  Fly   510 PT 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp28d1NP_608912.1 p450 35..477 CDD:278495 99/392 (25%)
Cyp12a4NP_650783.2 p450 72..531 CDD:299894 99/392 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.